Recombinant Rat Lipoma HMGIC fusion partner (Lhfp)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Lhfpl6; Lhfp; LHFPL tetraspan subfamily member 6 protein; Lipoma HMGIC fusion partner
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-200
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Lhfpl6
Target Protein Sequence
CVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSTEWR ICTIVTGLGCGLLLLVALTALMGCCVSELISRTVGRVAGGIQFLGGLLIGAGCALYPLGW DSEEVRQTCGYISDQFDLGKCEIGWAYYCTGAGAAAAMLLCTWLACFSGKKQKHYPY
Uniprot No.

Target Background

Database Links

KEGG: rno:499615

UniGene: Rn.6635

Protein Families
LHFP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Lipoma HMGIC fusion partner (Lhfp) and its role in genetics?

Lhfp is a member of the lipoma HMGIC fusion partner gene family, which belongs to the superfamily of tetraspan transmembrane protein encoding genes. This gene was first identified as a translocation partner of HMGIC in lipomas with t(12;13) chromosomal rearrangements . The gene is highly conserved across species, with homologs identified in humans, mice, rats, dogs, zebrafish, chickens, guinea pigs, cows, and other mammals . In rats, Lhfp is also known as RGD1560177 in some databases .

The significance of Lhfp lies in its involvement in:

  • Translocation events leading to lipoma formation

  • Bone mineral density regulation

  • Potential involvement in cellular differentiation pathways

How is Lhfp structurally characterized and how does it differ across species?

The rat Lhfp gene encodes a protein highly similar to the human LHFP. Based on sequence analyses, the predicted human LHFP protein contains 200 amino acids and is almost identical to translated mouse EST sequences that cover nearly the entire coding region . The conservation of Lhfp across species suggests critical biological functions:

SpeciesGene IDChromosome LocationProtein Length
Human10186Chromosome 13200 aa
Rat499615Chromosome 2Similar to human
Mouse108927Chromosome 3Similar to human
Zebrafish494110UnknownSimilar structure

The high degree of conservation indicates that Lhfp likely plays fundamental roles in cellular processes that have been preserved throughout evolution .

What methodologies are most effective for studying Lhfp function in rat models?

When investigating Lhfp function in rat models, researchers have successfully employed several methodologies:

  • Gene knockout approaches: CRISPR/Cas9 technology has been effectively used to generate Lhfp-deficient mice, suggesting similar approaches would be viable in rats. The technique involves co-injecting purified Cas9 mRNA (100 ng/μl) and sgRNA (30 ng/μl) into fertilized eggs .

  • Expression analysis: Northern blot analysis has been used to detect Lhfp transcript (2.4 kb) in various tissues. This approach allows for quantitative analysis of expression levels across different tissue types .

  • Co-expression network analysis: This approach helps identify genes functionally connected to Lhfp. In bone research, co-expression networks revealed Lhfp's connection to genes involved in osteoblast differentiation .

  • Cell-based functional assays: Colony-forming unit-fibroblast (CFU-F) assays and mineralization assays (alizarin red staining) have been used to assess the impact of Lhfp deficiency on bone marrow stromal cells .

How can researchers effectively validate Lhfp knockout models?

Validation of Lhfp knockout models requires multiple approaches to ensure complete and specific gene disruption:

  • Genomic validation: PCR screening of tail DNA using specific primers followed by sequencing to confirm mutations. For Lhfp knockout models, primers targeting the mutation site have been effective .

  • Transcript validation: qPCR with specific primers (e.g., primers 9 and 10 as used in previous studies) to assess Lhfp expression levels .

  • Protein validation: Western blot analysis using specific antibodies against Lhfp can confirm absence of protein. Recombinant Lhfp protein with ≥85% purity (as determined by SDS-PAGE) can serve as a positive control .

  • Functional validation: Phenotypic assessment through relevant assays, such as BMSCs differentiation assays for bone-related studies .

How does Lhfp contribute to bone physiology and what evidence supports its role?

Recent research has revealed Lhfp as a negative regulator of bone formation and bone mineral density (BMD). Evidence supporting this role includes:

  • Genome-wide association studies: A significant BMD locus on Chromosome 3@52.5 Mbp in mice that contains Lhfp was identified (P = 3.1 x 10^-12) .

  • Expression analysis: Lhfp is highly expressed in bone and osteoblasts, with expression regulated by a local expression QTL (eQTL) that overlaps with the BMD association .

  • Network analysis: Co-expression network studies revealed that Lhfp is strongly connected to genes involved in osteoblast differentiation .

  • Knockout models: Lhfp-deficient mice displayed:

    • Increased bone marrow stromal cell (BMSC) number

    • Enhanced BMSC osteogenic differentiation

    • Elevated BMD due to increased cortical bone mass

These findings collectively suggest that Lhfp functions as a negative regulator of osteoblast activity and bone mass, indicating that inhibiting Lhfp could represent a novel therapeutic strategy for osteoporosis .

What is known about the role of Lhfp in fusion events associated with neoplasms?

Lhfp was first identified as a translocation partner in lipomas, where it forms fusion proteins with HMGIC. The molecular mechanisms involve:

  • Chromosomal translocation: In lipomas with t(12;13), the HMGIC gene at 12q15 fuses with Lhfp located on chromosome 13 .

  • Fusion protein structure: The expressed HMGIC/LHFP fusion transcript encodes the three DNA binding domains of HMGIC followed by 69 amino acids encoded by frame-shifted LHFP sequences .

  • Prevalence: Gene fusion involving HMGIC appears to be a frequent aberration in mesenchymal tumors. Two primary mechanisms have been identified:

    • Direct translocation events creating chimeric genes

    • Aberrant splicing yielding variant products

In uterine leiomyomas, HMGIC gene fusions were found in 36% of tumors, with aberrant splicings to cryptic sequences in HMGIC introns in 11 cases, and translocations causing juxtaposition to other genes in 5 cases .

How can recombinant Lhfp be optimally produced for in vitro studies?

For optimal production of recombinant rat Lhfp for research applications, several expression systems have proven effective:

  • Cell-free expression systems: These have successfully produced recombinant rat Lhfp with ≥85% purity as determined by SDS-PAGE .

  • Bacterial, yeast, baculovirus, or mammalian cell systems: These systems have been used to produce partial rat Lhfp proteins, particularly for studies focusing on specific domains .

For validation and detection, researchers can use:

  • Protein G-purified antibodies with >95% purity

  • Conjugated antibodies (biotin, HRP, or FITC) for specific applications such as ELISA

When designing recombinant Lhfp constructs, consider:

  • Including affinity tags for purification

  • Codon optimization for the expression system

  • Signal peptides for proper membrane localization, given Lhfp's nature as a tetraspan transmembrane protein

What experimental strategies are most effective for studying Lhfp's interaction with other proteins?

Understanding Lhfp's interactions with other proteins requires sophisticated experimental approaches:

  • Co-immunoprecipitation: This technique can identify direct protein-protein interactions with Lhfp. Using recombinant Lhfp protein as a control (>85% purity) can help validate specificity .

  • Proximity labeling approaches: BioID or APEX2 fusion proteins can identify proximal proteins in the cellular context, particularly valuable for membrane proteins like Lhfp.

  • Co-expression network analysis: This computational approach has successfully identified Lhfp's functional connections to osteoblast differentiation genes. Module 9 in a bone co-expression network contained Lhfp and was enriched for genes directly involved in osteoblast differentiation .

  • Yeast two-hybrid screening: This can identify direct binding partners, though membrane proteins like Lhfp may require modified approaches using soluble domains.

  • Chromatin immunoprecipitation (ChIP): For studying how Lhfp fusion proteins affect transcriptional regulation, particularly in the context of HMGIC fusions .

How should researchers address conflicting data on Lhfp function across different experimental models?

When confronting contradictory findings on Lhfp function, researchers should:

  • Consider genetic background effects: The Hybrid Rat Diversity Panel (HRDP) studies reveal that genetic background significantly influences gene function. The HRDP consists of 96-98 inbred rat strains that maximize genetic diversity, providing a platform to study background effects .

  • Evaluate tissue-specific effects: Lhfp may have different functions in different tissues. For instance, while it negatively regulates bone formation , related family members like LHFPL3 promote proliferation in glioma cells .

  • Employ multiple knockout strategies: Different CRISPR/Cas9-induced mutations can produce varying phenotypes. Previous studies used five different mutant mouse lines with deletions ranging from 4bp to 16bp :

Mutant lineDeletion SizeBase pairs deletedMap position deleted
14 bpTGGG53043620–530436623
24 & 3 bpCCTG & TGG53043615–530436618; 53043620–530436622
38 bpTGG GTT GC53043620–530436627
411 bpCTG ATG GGT TG53043616–530436626
516 bpTCA CTG CCC TGA TGG G53043608–530436623
  • Integrate multi-omics data: Combine genomic, transcriptomic, and proteomic analyses to build a comprehensive understanding. For Lhfp, integrating GWAS data with eQTL and co-expression networks provided robust evidence for its role in bone physiology .

What statistical approaches are most appropriate for analyzing phenotypic changes in Lhfp-modified models?

When analyzing phenotypic data from Lhfp-modified models, researchers should consider:

  • Power calculations: Previous studies successfully identified significant effects with sample sizes of 16-week-old Lhfp+/+ and Lhfp-/- mice, combining data across sexes and adjusting for sex effects to increase statistical power .

  • Appropriate controls for genetic background: For rat studies, the HRDP provides a powerful framework for controlling genetic background, with 32-34 genetically diverse inbred strains and two panels of recombinant inbred panels .

  • Multifactorial analysis: When studying complex traits like bone mineral density, consider multiple factors:

    • CFU-F assays for BMSC number

    • Alizarin red quantification for mineralization capacity

    • Micro-CT for bone morphometric parameters

    • Mechanical testing for functional outcomes

  • Systems genetics approaches: Association mapping combined with expression QTL analysis and network modeling has proven effective in identifying Lhfp's role in bone physiology. The GWAS in mouse inbred strain panels successfully mapped Lhfp to BMD (P = 3.1 x 10^-12) .

What are the therapeutic implications of targeting Lhfp for bone disorders?

The identification of Lhfp as a negative regulator of bone formation offers promising therapeutic avenues:

  • Potential for osteoporosis treatment: Inhibiting Lhfp may represent a novel therapeutic strategy to increase bone mineral density, particularly relevant for osteoporosis .

  • Mechanism-based approach: Lhfp deficiency leads to:

    • Increased bone marrow stromal cell (BMSC) number

    • Enhanced osteogenic differentiation

    • Elevated cortical bone mass

  • Human relevance: SNPs in human LHFP were associated (P = 1.2 x 10^-5) with heel BMD, suggesting translational potential .

  • Development considerations: Any therapeutic targeting Lhfp would need to:

    • Achieve tissue-specific effects to avoid disrupting other functions

    • Consider potential effects on lipoma formation, given Lhfp's role in HMGIC fusion events

    • Account for potential compensatory mechanisms from other LHFP family members

How might researchers leverage new technologies to further elucidate Lhfp function?

Emerging technologies offer exciting opportunities to advance our understanding of Lhfp:

  • Single-cell transcriptomics: This could reveal cell-specific expression patterns and functions of Lhfp within heterogeneous tissues like bone marrow.

  • Advanced genome editing: Base editing or prime editing technologies could allow for more precise modifications of Lhfp to study specific domains or post-translational modifications.

  • In vivo imaging: Techniques like intravital microscopy combined with fluorescently tagged Lhfp could reveal its dynamic localization and interactions in living tissues.

  • Organoid models: These could provide more physiologically relevant systems to study Lhfp function in 3D tissue contexts.

  • AI-based structural predictions: With advances in protein structure prediction algorithms, researchers can generate more accurate models of Lhfp's structure and potential interaction interfaces.

  • Systems biology approaches: Building on the success of previous co-expression network analyses , more comprehensive multi-omics integration could reveal broader functional networks involving Lhfp.

What controls are essential when designing experiments with recombinant rat Lhfp?

When working with recombinant rat Lhfp, researchers should implement several critical controls:

  • Protein quality controls:

    • Verification of protein purity (≥85% by SDS-PAGE)

    • Confirmation of proper folding through circular dichroism or functional assays

    • Testing for endotoxin contamination, especially for in vivo applications

  • Expression controls:

    • Empty vector controls for overexpression studies

    • Non-targeting control for knockdown studies

    • Wild-type littermates for knockout studies, as used in previous Lhfp knockout studies

  • Specificity controls:

    • For antibody-based detection, pre-incubation with recombinant protein control fragments can verify specificity

    • For recombinant protein blocking experiments, a 100x molar excess of the protein fragment control is recommended

  • Experimental model validation:

    • For rat models, the HRDP resource provides well-characterized strains with known genetic backgrounds

    • When using tumor models like the WAG/Rij rat rhabdomyosarcoma model, careful tumor volume monitoring using the formula A × B × C × π/6 is essential

How should researchers approach studying Lhfp in complex disease models?

When investigating Lhfp in complex disease contexts, researchers should:

  • Consider model selection carefully:

    • The WAG/Rij rat model has been used for tumor studies and might be suitable for studying Lhfp in neoplasms

    • The Hybrid Rat Diversity Panel (HRDP) provides a powerful platform for systems genetics studies with controlled genetic backgrounds

  • Implement comprehensive phenotyping:

    • For bone studies, combine multiple measures (BMD, micro-CT, histomorphometry, mechanical testing)

    • For tumor studies, complementary approaches like PET imaging and immunohistochemical staining can validate findings

  • Account for temporal dynamics:

    • In studies of repopulating cells, time-course analyses are crucial, as demonstrated in Leydig cell repopulation studies

    • For bone development studies, age-matched controls are essential (16-week-old mice were used in previous studies)

  • Integrate multiple data types:

    • Combine genomic, transcriptomic, and proteomic data for comprehensive insights

    • Network-based approaches can help interpret complex data and identify key pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.