Recombinant Rat Long-chain-fatty-acid--CoA ligase 5 (Acsl5)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Lipid Metabolism

ACSL5 activates long-chain fatty acids (LCFAs) by forming acyl-CoA thioesters, directing them toward lipid synthesis or β-oxidation. Key findings from studies using recombinant rat ACSL5 include:

Table 1: Metabolic Functions of Recombinant Rat ACSL5

Study SystemKey FindingsReference
Rat hepatoma cellsOverexpression increases triacylglycerol (TAG) synthesis by 42% via exogenous fatty acids.
HepG2 cells (human)Enhances β-oxidation of palmitate by 49.5%, contrasting rodent-specific TAG partitioning.
In vitro assaysBimodal pH activity (peaks at pH 7.5 and 9.5) observed in human intestinal cell lines.
siRNA knockdown modelsReduces cellular TAG content and promotes fatty acid oxidation in rodent hepatocytes.

Cloning and Induction

  • Expression Constructs: Full-length Acsl5 cDNA cloned into pET22b(+) or pQE-30Xa vectors .

  • Induction: Optimized with 1 mM IPTG at 16–28°C for 4–24 hours .

Purification Protocol

  1. Lysis: Sonication in Tris-EDTA buffer with Triton X-100/cholate .

  2. Ultracentrifugation: Removes insoluble fractions .

  3. Ni²⁺-Affinity Chromatography: Yields >90% pure protein with specific activity of 1.08–2.31 nmol/min/mg .

Inhibitor Sensitivity

Recombinant rat ACSL5 exhibits species-specific responses to inhibitors:

InhibitorEffect on Rat ACSL5Effect on Human ACSL5IC₅₀
Triacsin CNo significant inhibition 50% inhibition at ~10 µM 10 µM (human)

This divergence is attributed to 81% sequence identity between rat and human ACSL5, particularly in ATP-binding domains .

Research Applications

  • Enzyme Kinetics: Measuring acyl-CoA synthetase activity under varying pH/substrate conditions .

  • Metabolic Tracing: Studying fatty acid partitioning into TAG vs. β-oxidation pathways .

  • Immunodetection: Anti-His or anti-ACSL5 antibodies (e.g., KD7) for Western blotting .

  • Cellular Localization: Confocal microscopy confirms mitochondrial/ER association in hepatoma cells .

Key Research Findings

  1. TAG Synthesis Regulation: ACSL5 overexpression in rat hepatocytes selectively channels exogenous fatty acids into TAG, not endogenous pools .

  2. Species-Specific Roles: Rat ACSL5 primarily drives lipogenesis, while human orthologs increase β-oxidation in hepatic models .

  3. pH-Dependent Activity: Dual pH optima (7.5 and 9.5) suggest isoform-specific regulatory mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are sent with standard blue ice packs. For dry ice shipping, please contact us in advance, as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Acsl5; Acs5; Facl5; Long-chain-fatty-acid--CoA ligase 5; Arachidonate--CoA ligase; Long-chain acyl-CoA synthetase 5; LACS 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-683
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MLFIFNFLFSPLPTPALICLLTFGTAIFLWLINRPQPVLPLIDLDNQSVGIEGGARRGAFQKNNDLILYYFSDAKTLYEVFQRGLAVSDNGPCLGYRKPNQPYKWISYKQVSDRAEYLGSCLLHKGYKPSQDQFIGIFAQNRPEWVISELACYTYSMVAVPLYDTLGAEAIIYVINRADISVVICDTPQKATMLIENVEKDLTPGLKTVILMDPFDDDLMKRGEKCGIEMLSLHDAENLGKENFKKPMPPNPEDLSVICFTSGTTGDPKGAMLTHQNIVSNMAAFLKFLEPIFQPTPEDVTISYLPLAHMFERLVQGVIFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYDKVQNEAKTPLKKFLLNLAIISKFNEVRNGIIRRNSLWDKLVFSKIQSSLGGKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTAGCSITSPGDWTAGHVGTPVSCNFVKLEDVADMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENVYSRSRPILQVFVHGESLRSFLIGVVVPDPESLPSFAAKIGVKGSFEELCQNQCVKKAILEDLQKVGKEGGLKSFEQVKSIFVHPEPFSIENGLLTPTLKAKRVELAKFFQTQIKSLYESIEE
Uniprot No.

Target Background

Function
ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5) is an enzyme that catalyzes the conversion of long-chain fatty acids into their active form, acyl-CoAs. This process is essential for both the synthesis of cellular lipids and the degradation of lipids via beta-oxidation. ACSL5 may sensitize epithelial cells to apoptosis, specifically triggered by the death ligand TRAIL, at the villus tip of the crypt-villus axis of the small intestine. It may also play a role in the survival of glioma cells. Additionally, ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage. It has been suggested that ACSL5 may also stimulate fatty acid oxidation. This enzyme exhibits a broad range of activity towards saturated fatty acids, with a preference for C16-C18 unsaturated fatty acids.
Database Links
Protein Families
ATP-dependent AMP-binding enzyme family
Subcellular Location
Mitochondrion. Endoplasmic reticulum. Mitochondrion outer membrane; Single-pass type III membrane protein. Endoplasmic reticulum membrane; Single-pass type III membrane protein. Cell membrane.
Tissue Specificity
Expressed most abundantly in the small intestine, and to a much lesser extent in the lung, liver, adrenal gland, adipose tissue and kidney.

Q&A

What is Rat Long-chain-fatty-acid--CoA ligase 5 (Acsl5) and its primary function?

The enzyme is defined by several key characteristics:

  • Full-length rat Acsl5 protein consists of 683 amino acids

  • Its substrate specificity includes long-chain fatty acids

  • Activity requires ATP and CoA as cofactors

  • Functions in a tissue-specific manner, with notable expression in intestinal epithelium and liver

How is Acsl5 structurally and functionally different from other ACSL isoforms?

ACSL5 is distinguished from other ACSL isoforms by several key features:

FeatureACSL5Other ACSL Isoforms
Subcellular localizationMitochondria and endoplasmic reticulum Primarily plasma membrane, ER, or peroxisomes
Metabolic fate of activated FAsPrimarily directs toward TAG synthesis Various metabolic fates (oxidation, phospholipid synthesis)
Expression patternEnriched in intestinal mucosa and liverTissue-specific distribution patterns
Response to nutritional statusRegulated by feeding/fasting cyclesIsoform-specific regulatory patterns

This unique combination of properties positions ACSL5 at a metabolic crossroads, controlling the partitioning of fatty acids between storage and energy production pathways.

What expression systems are most effective for producing recombinant Rat Acsl5?

E. coli represents a well-established expression system for producing recombinant rat ACSL5 protein . When designing expression strategies, researchers should consider:

  • Construct design: The full-length protein (1-683aa) with an N-terminal His tag facilitates purification while maintaining functional properties

  • Expression conditions: Optimization of induction parameters (temperature, IPTG concentration, duration) is critical for maximizing yield

  • Purification approach: Affinity chromatography using nickel resins yields protein with >90% purity as determined by SDS-PAGE

  • Protein stability: Storage as lyophilized powder, with reconstitution in deionized sterile water (0.1-1.0 mg/mL) and addition of 5-50% glycerol for long-term storage at -20°C/-80°C

For functional studies in cellular contexts, mammalian expression systems using adenoviral vectors have successfully delivered ACSL5 to hepatoma cell lines, enabling metabolic studies .

How can researchers accurately measure Acsl5 enzymatic activity in vitro?

Accurate measurement of ACSL5 activity requires careful consideration of assay conditions and detection methods:

  • Radioisotope-based assays: The gold standard involves measuring activation of [1-14C]oleic acid to [1-14C]oleoyl-CoA, with quantification by thin-layer chromatography or extraction methods

  • Spectrophotometric approaches: Coupled enzyme assays that link AMP or pyrophosphate production to detectable signals

  • Key parameters to control:

    • Substrate concentration (typically 500 μM fatty acid is effective)

    • CoA and ATP concentrations

    • pH optimization (typically 7.4-8.0)

    • Detergent selection and concentration

    • Reaction temperature and duration

When measuring ACSL5 activity specifically, selective inhibitors of other ACSL isoforms should be included to eliminate background activity.

What methodologies effectively track the metabolic fate of fatty acids processed by Acsl5?

To track the metabolic fate of fatty acids activated by ACSL5, researchers have successfully employed:

  • Pulse-chase experiments with radiolabeled fatty acids: Studies with [1-14C]oleic acid have revealed that ACSL5 overexpression increases incorporation into cellular TAG by 42% but does not substantially affect metabolism to acid-soluble metabolites, phospholipids, or medium TAG

  • Dual tracer approaches: Using [1-14C]oleate and [1,2,3-3H]glycerol simultaneously can distinguish between de novo and reacylation pathways in TAG synthesis. This approach demonstrated that ACSL5 enhances TAG synthesis through both pathways

  • Selective pathway analysis: Employing [1-14C]acetic acid specifically tracks de novo fatty acid synthesis pathways, revealing that ACSL5 does not significantly affect the metabolism of fatty acids derived from this source

  • Subcellular fractionation: Isolating mitochondria, ER, and lipid droplets after metabolic labeling helps determine compartment-specific effects of ACSL5 on fatty acid trafficking

This multi-faceted approach is essential for understanding ACSL5's role in directing fatty acid flux.

How should researchers design overexpression studies to analyze Acsl5 function?

Well-designed overexpression studies are critical for elucidating ACSL5 function:

  • Vector selection: Adenoviral vectors (e.g., Ad-ACSL5) provide efficient transduction and expression in relevant cell types, with appropriate controls (e.g., Ad-GFP)

  • Expression verification: Confirmation of increased expression and activity is essential - a 2-fold increase in acyl-CoA synthetase activity has been demonstrated in Ad-ACSL5 infected cells compared to controls

  • Localization analysis: Confocal microscopy should be used to verify that overexpressed ACSL5 maintains proper subcellular localization to both mitochondria and endoplasmic reticulum

  • Temporal considerations: Activity and metabolic changes should be assessed at defined time points after expression induction (typically 24h post-infection)

  • Dose-response relationships: Testing multiple levels of ACSL5 expression helps establish physiologically relevant effects versus potential artifacts of extreme overexpression

The inclusion of appropriate controls and careful validation of expression are critical for interpreting results correctly.

How does Acsl5 overexpression specifically affect cellular fatty acid uptake mechanisms?

ACSL5 overexpression significantly enhances cellular fatty acid uptake through a process called "metabolic trapping":

  • Quantitative impact: Ad-ACSL5-infected cells exhibit 30% higher rates of fatty acid uptake when incubated with 500 μM [1-14C]oleic acid compared to control cells

  • Mechanistic basis: By rapidly converting incoming fatty acids to acyl-CoAs, ACSL5 prevents their efflux and effectively "traps" them inside the cell

  • Substrate specificity: The effect appears most pronounced for exogenous fatty acids rather than those derived from de novo synthesis

  • Metabolic consequences: Enhanced uptake directly correlates with increased TAG synthesis (42% increase) rather than oxidation or other metabolic fates

This relationship between fatty acid uptake and metabolism demonstrates that cellular fatty acid import is not merely a passive process but is actively regulated by metabolic enzymes like ACSL5.

What is the evidence that Acsl5 preferentially directs fatty acids toward TAG synthesis rather than oxidation?

Despite ACSL5's partial localization to mitochondria, several lines of evidence indicate it preferentially channels fatty acids toward TAG synthesis:

  • Metabolic fate analysis: Overexpression of ACSL5 increases metabolism of [1-14C]oleic acid to cellular TAG by 42% but does not substantially affect metabolism to acid-soluble metabolites (which would include β-oxidation products)

  • Pathway analysis: ACSL5 enhances TAG synthesis through both de novo and reacylation pathways, as demonstrated by similar incorporation rates of [1-14C]oleate and [1,2,3-3H]glycerol into TAG

  • Compartmentalization effects: Despite mitochondrial localization, ACSL5 does not promote mitochondrial fatty acid oxidation, suggesting that its spatial organization within the organelle may segregate it from the β-oxidation machinery

  • Selectivity for exogenous sources: ACSL5 selectively channels exogenously derived fatty acids rather than those produced by de novo synthesis, as shown by unchanged [1-14C]acetic acid incorporation into cellular lipids upon ACSL5 overexpression

This metabolic channeling function positions ACSL5 as an important regulator of cellular lipid storage.

How are Acsl5 activity and expression regulated in different physiological states?

ACSL5 activity and expression undergo dynamic regulation in response to various physiological conditions:

Physiological StateEffect on ACSL5Metabolic Consequence
Fasting stateAltered activity without substantial expression changesReduced TAG synthesis
High-fat feedingIncreased expression in intestinal epitheliumEnhanced fatty acid absorption
Insulin stimulationActivation through post-translational modificationsIncreased TAG storage
Inflammatory conditionsAltered expression in tissue-specific mannerModified lipid metabolism

The regulatory mechanisms include:

  • Transcriptional control through metabolic sensing transcription factors

  • Post-translational modifications affecting enzyme activity

  • Protein-protein interactions modulating substrate accessibility

  • Subcellular relocalization in response to metabolic signals

This multi-layered regulation allows ACSL5 to adapt fatty acid metabolism to changing nutritional and energy demands.

How can Acsl5 function be studied using knockout or knockdown approaches?

For effective genetic manipulation of ACSL5:

  • RNA interference approaches:

    • siRNA or shRNA targeting specific regions of ACSL5 mRNA

    • Validation of knockdown efficiency by qRT-PCR and Western blotting

    • Control for off-target effects with scrambled sequences

    • Analysis of compensatory upregulation of other ACSL isoforms

  • CRISPR-Cas9 gene editing:

    • Design of guide RNAs targeting exonic regions of the ACSL5 gene

    • Screening for complete versus hypomorphic alleles

    • Clonal isolation of edited cells

    • Comprehensive characterization of the metabolic phenotype

  • Metabolic phenotyping:

    • Baseline lipid profiling with and without fatty acid challenges

    • Pulse-chase studies with labeled fatty acids to determine altered metabolic flux

    • Analysis of gene expression changes for compensatory mechanisms

    • Assessment of cellular energetics and mitochondrial function

These approaches complement overexpression studies by revealing the necessity of ACSL5 for specific metabolic processes.

What are the key considerations for designing experiments to resolve contradictory findings about Acsl5 function?

When addressing contradictory findings regarding ACSL5 function, researchers should consider:

  • Experimental context differences:

    • Cell/tissue type specificity (hepatic versus intestinal models)

    • Acute versus chronic manipulation of ACSL5 levels

    • Nutritional status of experimental models

    • Species differences in ACSL5 function

  • Methodological considerations:

    • Assay sensitivity and specificity

    • Substrate concentrations and compositions

    • Isolation procedures for subcellular fractions

    • Detection methods for metabolic endpoints

  • Experimental design strategies:

    • Side-by-side comparison of contradictory protocols

    • Systematic variation of key parameters

    • Inclusion of multiple complementary endpoints

    • Collaboration between laboratories with differing results

A carefully designed factorial experimental approach can help resolve apparent contradictions by identifying the specific conditions under which different ACSL5 functions predominate.

How can researchers distinguish between the direct enzymatic effects of Acsl5 and its secondary metabolic consequences?

Distinguishing direct from secondary effects requires sophisticated experimental approaches:

  • Enzymatically inactive mutants:

    • Creation of catalytically inactive ACSL5 through site-directed mutagenesis

    • Comparison of effects between wild-type and mutant expression

    • Analysis of protein-protein interactions independent of catalytic function

  • Temporal resolution:

    • Time-course experiments capturing immediate versus delayed responses

    • Pulse-chase approaches with tight temporal control

    • Inducible expression systems allowing precise timing of ACSL5 activation

  • Metabolic inhibitor strategies:

    • Selective blocking of downstream pathways

    • Isotope tracing combined with metabolic inhibitors

    • Mathematical modeling of direct versus indirect effects

  • In vitro reconstitution:

    • Purified components systems with defined constituents

    • Liposome reconstitution with controlled lipid composition

    • Direct measurement of enzymatic products in isolation

These approaches help delineate ACSL5's primary catalytic functions from the broader metabolic adaptations they trigger.

What are common issues in purification and storage of recombinant Acsl5 protein?

Researchers frequently encounter challenges with recombinant ACSL5:

  • Purification challenges:

    • Protein solubility issues due to ACSL5's membrane association

    • Potential for aggregation during extraction and purification

    • Co-purification of bacterial lipids affecting activity

    • Maintaining native conformation during purification steps

  • Storage considerations:

    • Avoid repeated freeze-thaw cycles which substantially reduce activity

    • Store working aliquots at 4°C for maximum one week

    • Lyophilized protein requires proper reconstitution in deionized sterile water

    • Addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C

  • Activity preservation:

    • Monitor enzymatic activity before and after storage

    • Include appropriate protease inhibitors to prevent degradation

    • Consider stabilizing additives such as reducing agents or specific lipids

    • Validate activity with standardized assays after each preparation

Addressing these challenges is crucial for obtaining reliable results in ACSL5 functional studies.

How can researchers validate the specificity of observed effects in Acsl5 research?

Validating that observed effects are specifically due to ACSL5 requires several control approaches:

  • Isoform specificity controls:

    • Parallel experiments with other ACSL isoforms

    • Use of isoform-selective inhibitors when available

    • qRT-PCR analysis to ensure other ACSL isoforms are not inadvertently affected

  • Rescue experiments:

    • Restoration of phenotype by reintroduction of ACSL5 after knockdown

    • Complementation analysis with different ACSL5 variants

    • Dose-dependent recovery correlating with expression level

  • Substrate and pathway controls:

    • Utilization of fatty acid substrates with different chain lengths and saturation

    • Inclusion of metabolic pathway inhibitors to confirm mechanism

    • Analysis of multiple metabolic endpoints to establish specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.