Recombinant Rat Lysophosphatidylcholine acyltransferase 2B (Lpcat2b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Lpcat2b; Aytl1b; Lysophosphatidylcholine acyltransferase 2B; Acyltransferase-like 1-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-517
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Lpcat2b
Target Protein Sequence
MAHQTQRRDTADTMTEVEVWDSRTAQEVNKSLYPPAVTNPFTHHTQLSAWQLACSIFLGT VLVPVRVSCIVFLFLLLWPVALLSTINLPIQPTEPVKSWRKHLIKPVFIFLLRLAFFCAG FLIKVKGKKATREEAPIFVVAPHSTFFDAIAVIVAGLPSVVSDTQHVRIPLVGQCILLTQ PVLVRREDPNSRKTTRNEILSRVKSKMKWPQILIFPEGLCTNRSCLVTFKLGAFSPGVPV QPVLLRYPNTLDTVTWTWHGFSGFQVCMLTLSQPFTRMEVEFMPVYIPNEDEKKDPILFA NTVRINMANALKLPVTDHSFEDCKLMISAGALRLPMEAGLVEFTKISQKLKLDWDNIHTH LDKYASVAVSSKGGKIGIEEFSRYLKLPISEPLRQLFSLFDRNQDGTIDFREYVIGLTVL CNPANTEKILQMSFKLFDLDEDGYITEQELTTMLRAAFGVPDLDVSTLFQQMAGKDSAQV SYRTFRRFALKHPAYAKLFHSYIDLQAAYIYSLPGEV
Uniprot No.

Target Background

Function

Probable acetyltransferase.

Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Lysophosphatidylcholine Acyltransferase 2B (Lpcat2b) and how is it related to LPCAT2?

Lpcat2b (also known as Aytl1b or Acyltransferase-like 1-B) is a member of the lysophosphatidylcholine acyltransferase family that catalyzes the reacylation of lysophosphatidylcholine to form phosphatidylcholine. Lpcat2b is a variant of LPCAT2, with both being part of a family of enzymes that play crucial roles in phospholipid remodeling and inflammatory responses. The rat recombinant protein consists of 517 amino acids and is frequently expressed in E. coli systems for research purposes . LPCAT2 has been extensively studied for its role in mediating inflammatory responses to bacterial ligands, particularly lipopolysaccharide (LPS) .

What are the optimal conditions for expressing recombinant rat Lpcat2b in E. coli systems?

For optimal expression of recombinant rat Lpcat2b in E. coli systems, researchers should consider the following methodology:

  • Vector selection: Use expression vectors containing strong promoters (such as T7) and appropriate fusion tags (His-tag is commonly used for Lpcat2b)

  • E. coli strain: BL21(DE3) or Rosetta strains are preferred for membrane protein expression

  • Induction parameters:

    • Temperature: 16-20°C for overnight expression to enhance proper folding

    • IPTG concentration: 0.1-0.5 mM depending on strain and construct

    • Optical density at induction: OD600 of 0.6-0.8

Expression in E. coli has been successfully demonstrated for Lpcat2b and related family members, generating functional protein capable of converting lysophosphatidylcholine to phosphatidylcholine in the presence of long-chain acyl-CoA .

How should recombinant Lpcat2b protein be stored and reconstituted to maintain optimal enzymatic activity?

For optimal storage and reconstitution of recombinant Lpcat2b:

Storage ConditionRecommendationNotes
Short-term storage4°CUp to one week
Long-term storage-20°C to -80°CAliquoting is necessary for multiple use
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Helps maintain stability
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLBrief centrifugation before opening is recommended
Glycerol addition5-50% (final concentration)50% is standard; helps prevent freeze-thaw damage

Repeated freeze-thaw cycles should be avoided as they significantly reduce enzymatic activity. Working aliquots can be stored at 4°C for up to one week . When planning experiments, it's advisable to prepare small aliquots during initial reconstitution to minimize freeze-thaw cycles.

What assays can be used to measure the enzymatic activity of recombinant Lpcat2b?

Several methodological approaches can be employed to measure Lpcat2b enzymatic activity:

  • Radiometric assay: Using radiolabeled acyl-CoA (typically [14C] or [3H] labeled) and monitoring incorporation into phosphatidylcholine

    • Substrate: LysoPC and [14C]palmitoyl-CoA or other acyl-CoA derivatives

    • Detection: Thin-layer chromatography followed by autoradiography or scintillation counting

    • Quantification: Percentage conversion of substrate to product

  • Fluorescence-based assay: Using fluorescent labeled lysoPC or acyl-CoA

    • Advantages: Continuous monitoring of reaction kinetics possible

    • Equipment needed: Fluorometer or plate reader with appropriate filters

  • HPLC/MS-based assay: For detailed product characterization

    • Particularly useful for determining acyl chain specificity

    • Can provide quantitative data on multiple reaction products simultaneously

When performing these assays, it's critical to include appropriate controls including heat-inactivated enzyme samples and reactions without key substrates to account for background activity .

How does LPCAT2/Lpcat2b activity differ from LPCAT1 in inflammatory response models?

The functional differentiation between LPCAT2/Lpcat2b and LPCAT1 in inflammatory response models reveals distinct roles:

CharacteristicLPCAT2/Lpcat2bLPCAT1
Basal expressionLower (8-fold less than LPCAT1 in RAW264.7 cells)Higher constitutive expression
Response to TLR stimulationSignificantly upregulated by TLR2 and TLR4 ligandsNot significantly altered by LPS or LTA stimulation
Role in inflammatory responsesRequired for cytokine gene expression in response to TLR ligandsNo significant role in inflammatory gene expression
TLR associationRapidly associates with TLR4 and translocates to lipid rafts upon LPS stimulationDoes not associate with TLR4 in response to LPS
Impact on MAPK signalingActs upstream of p38 MAPKNo significant impact on p38 phosphorylation
SpecificityRegulates TLR-mediated responses but not TLR-independent stimuliNot involved in TLR responses

These differences highlight that LPCAT2/Lpcat2b plays a specific role in mediating inflammatory responses to bacterial ligands, while LPCAT1 primarily serves in constitutive membrane phospholipid remodeling. RNAi-based knockdown experiments demonstrate that LPCAT2, but not LPCAT1, is required for macrophage cytokine gene expression in response to TLR4 and TLR2 ligand stimulation .

How do divalent cations affect Lpcat2b enzymatic activity and what structural elements are involved?

Divalent cations, particularly Ca²⁺ and Mg²⁺, have significant modulatory effects on Lpcat2b activity through the following mechanisms:

  • Inhibitory effect: Calcium and magnesium ions inhibit LPCAT activity of Lpcat2b

  • Structural basis: The inhibition is mediated through EF-hand motifs present in the C-terminus of the protein

  • Physiological implications: This suggests that not only deacylation (phospholipase action) but also reacylation in cells can be modulated by divalent cations

The EF-hand motifs in Lpcat2b provide a calcium-sensing mechanism that can regulate enzymatic activity in response to changes in intracellular calcium levels. This calcium-dependent regulation offers an additional layer of control over phospholipid remodeling during cellular responses to external stimuli .

For experimental work, researchers should be aware that buffer composition, particularly the presence of calcium or magnesium, can significantly impact enzymatic assay results. Chelating agents like EDTA or EGTA may be used to control divalent cation concentrations when characterizing the intrinsic activity of the enzyme.

What splice variants of Lpcat family members have been identified and how do they affect catalytic activity?

Splice variants affecting catalytic activity have been identified in the Lpcat family:

  • AYTL1 (related to Lpcat2b): Splice variants affecting a conserved catalytic motif have been identified

  • Functional impact: These variants likely have altered catalytic properties since they affect critical domains in the protein

  • Expression patterns: Different splice variants may show tissue-specific expression patterns

When working with recombinant Lpcat2b, researchers should verify which splice variant they are expressing and ensure consistency across experiments. The functional significance of these variants may provide insights into tissue-specific regulation of phospholipid remodeling .

How can recombinant Lpcat2b be used to study macrophage inflammatory responses to bacterial infections?

Recombinant Lpcat2b provides a valuable tool for studying macrophage inflammatory responses through several methodological approaches:

  • Overexpression studies:

    • Transfection of RAW264.7 macrophages or primary cells with Lpcat2b expression vectors

    • Assessment of inflammatory gene expression (TNF-α, IL-6, IL-1β) in response to LPS or other TLR ligands

    • Flow cytometric analysis of surface receptor expression (TLR4, CD14)

  • Structure-function analysis:

    • Creation of point mutations in catalytic domains or EF-hand motifs

    • Assessment of impact on enzymatic activity and inflammatory response

    • Identification of critical residues for protein-protein interactions

  • Interaction studies:

    • Co-immunoprecipitation experiments to identify Lpcat2b-interacting proteins

    • Fluorescence microscopy to track Lpcat2b translocation to membrane lipid rafts upon stimulation

Research has shown that LPCAT2 regulates CD14 and TLR4 gene expression, with macrophages overexpressing LPCAT2 showing significantly increased TLR4 gene expression with or without LPS treatment. Additionally, CD14 gene expression was markedly higher in macrophages overexpressing LPCAT2 and infected with E. coli O111:B4 .

What is the relationship between Lpcat2b activity and membrane lipid composition during immune cell activation?

The relationship between Lpcat2b activity and membrane lipid composition during immune cell activation involves sophisticated mechanistic interactions:

  • Membrane remodeling dynamics:

    • Lpcat2b catalyzes the incorporation of specific fatty acyl chains into lysophosphatidylcholine

    • This alters the phospholipid composition of immune cell membranes during activation

    • Changes in membrane fluidity affect receptor clustering and signaling complex formation

  • Lipid raft associations:

    • Upon LPS stimulation, LPCAT2 (related to Lpcat2b) translocates to membrane lipid raft domains

    • This translocation coincides with association with TLR4, suggesting a direct role in modulating TLR4 signaling

    • The altered lipid composition may facilitate the assembly of TLR signaling complexes

  • Temporal regulation:

    • Initial membrane phospholipid remodeling occurs rapidly (minutes) following stimulation

    • This precedes transcriptional responses, suggesting a causal relationship

    • Sustained changes in membrane composition may contribute to prolonged inflammatory responses

Research using recombinant Lpcat2b has demonstrated that this enzyme not only responds to inflammatory stimuli but actively contributes to shaping the immune response through dynamic modification of membrane properties .

How do rat Lpcat2b and human LPCAT2 compare in terms of structure and function?

A comparative analysis of rat Lpcat2b and human LPCAT2 reveals important similarities and differences:

CharacteristicRat Lpcat2bHuman LPCAT2Notes
Sequence homologyReferenceHigh conservation in catalytic domainsCritical motifs for acyltransferase activity are preserved
Tissue expressionHighly expressed in immune cellsSimilar pattern with expression in immune cellsConservation of tissue-specific expression suggests functional conservation
Substrate specificityUtilizes long-chain acyl-CoA with lysoPCSimilar specificity profileBoth preferentially incorporate polyunsaturated fatty acids
Regulatory mechanismsRegulated by divalent cations via EF-hand motifsContains similar regulatory domainsConserved regulation suggests functional importance
TLR responseModulates TLR signalingSimilar role in inflammatory responsesConserved role in immunity across species

What is the evolutionary relationship between Lpcat2b and other acyltransferase family members?

The evolutionary relationships among Lpcat2b and other acyltransferase family members reveal fascinating insights into functional specialization:

  • Phylogenetic clustering:

    • LPCAT family members (AYTL1/LPCAT1, AYTL2/LPCAT2, and AYTL3/LPCAT3) form a distinct clade within the larger acyltransferase superfamily

    • Lpcat2b appears most closely related to AYTL1b based on sequence similarity

  • Domain architecture conservation:

    • All family members contain conserved acyltransferase domains

    • The presence of regulatory elements (such as EF-hand motifs) varies among family members, suggesting diversification of regulatory mechanisms

  • Functional divergence:

    • While Lpcat1 appears primarily involved in constitutive membrane remodeling, Lpcat2/Lpcat2b has evolved specialized functions in inflammatory responses

    • This functional specialization likely occurred after gene duplication events

Understanding these evolutionary relationships helps explain the distinct roles of different LPCAT isoforms in cellular processes. While LPCAT1 maintains basic membrane homeostasis, LPCAT2/Lpcat2b appears to have evolved specialized functions in immune response regulation .

What are common challenges when working with recombinant Lpcat2b and how can they be addressed?

Researchers often encounter several challenges when working with recombinant Lpcat2b. Here are methodological solutions to address these issues:

  • Low expression levels:

    • Solution: Optimize codon usage for E. coli expression

    • Method: Use lower induction temperatures (16-18°C) and extended expression times (overnight)

    • Alternative: Consider expression in eukaryotic systems for proper post-translational modifications

  • Protein insolubility:

    • Solution: Include mild detergents in lysis and purification buffers

    • Recommended detergents: 0.1% Triton X-100 or 0.5% CHAPS

    • Alternative approach: Use fusion partners like MBP or SUMO to enhance solubility

  • Loss of enzymatic activity:

    • Solution: Add stabilizing agents to storage buffer

    • Effective additives: 6% trehalose, 10% glycerol, or 1mM DTT

    • Consideration: Aliquot immediately after purification to minimize freeze-thaw cycles

  • Interference from divalent cations:

    • Solution: Carefully control buffer composition during enzymatic assays

    • Method: Include EDTA (1-5mM) to chelate divalent cations when measuring baseline activity

    • Control experiment: Systematically test activity with defined concentrations of Ca²⁺ or Mg²⁺

Careful attention to these details will significantly improve the reliability and reproducibility of experiments involving recombinant Lpcat2b .

How can siRNA or shRNA approaches be optimized for studying Lpcat2b function in different cell types?

Optimizing RNA interference approaches for studying Lpcat2b function requires careful methodological considerations:

  • siRNA design considerations:

    • Target selection: Design 3-4 siRNAs targeting different regions of Lpcat2b mRNA

    • Specificity: Ensure minimal off-target effects by BLAST analysis

    • Control: Include scrambled siRNA with similar GC content

    • Validation: Verify knockdown efficiency by both RT-qPCR and Western blot

  • Cell type-specific optimization:

    • RAW264.7 macrophages: Transfection efficiency of 70-80% can be achieved using lipid-based transfection reagents

    • Primary macrophages: Nucleofection typically yields higher efficiency than lipid-based methods

    • Human monocytic cell lines (like MM6): shRNA delivered via lentiviral vectors provides stable knockdown

  • Knockdown validation protocol:

    • RNA isolation: 24-48 hours post-transfection

    • Protein analysis: 48-72 hours post-transfection

    • Functional assays: Initiate 48-72 hours post-transfection

    • Expected knockdown: 70-80% reduction in mRNA levels is typically sufficient to observe phenotypic effects

  • Functional readouts:

    • Inflammatory response: Measure cytokine production (TNF-α, IL-6) by ELISA

    • Signaling pathways: Assess p38 MAPK phosphorylation by Western blot

    • Gene expression: Monitor TLR4 and CD14 expression by RT-qPCR

Research has demonstrated that knockdown of LPCAT2 (related to Lpcat2b) in various cell types results in significant inhibition of LPS-stimulated inflammatory cytokine expression and protein release, confirming the importance of optimized RNAi approaches for studying this enzyme's function .

What are potential therapeutic applications for targeting Lpcat2b in inflammatory diseases?

The emerging understanding of Lpcat2b's role in inflammation suggests several promising therapeutic applications:

  • Sepsis intervention:

    • Rationale: LPCAT2 mediates inflammatory responses to bacterial ligands

    • Approach: Small molecule inhibitors of Lpcat2b could reduce cytokine storm in sepsis

    • Advantage: Targeting a specific regulatory enzyme may offer better control than broad immunosuppression

  • Chronic inflammatory conditions:

    • Target conditions: Inflammatory bowel disease, rheumatoid arthritis

    • Mechanism: Modulation of TLR-mediated inflammatory signaling

    • Approach: Selective inhibition of inducible but not constitutive LPCAT activity

  • Precision medicine opportunities:

    • Genetic analysis: Identify polymorphisms in LPCAT2/Lpcat2b associated with inflammatory phenotypes

    • Biomarker development: LPCAT2 activity as a predictor of inflammatory response

    • Patient stratification: Guide therapeutic intervention based on LPCAT2 expression or activity

Research has shown that LPCAT2 plays a key role in macrophage inflammatory gene expression in response to bacterial ligands, suggesting it could be a potential therapeutic target for development of anti-inflammatory and anti-sepsis therapies . Further investigation with recombinant Lpcat2b will be essential for drug development and validation.

What emerging technologies could advance our understanding of Lpcat2b's role in phospholipid remodeling?

Several cutting-edge technologies hold promise for deepening our understanding of Lpcat2b's functions:

  • CRISPR/Cas9 genome editing:

    • Application: Generate precise mutations in endogenous Lpcat2b

    • Advantage: Avoid artifacts associated with overexpression

    • Approach: Create cell lines with modifications in catalytic domains or regulatory regions

  • Lipidomics with high-resolution mass spectrometry:

    • Application: Comprehensive analysis of membrane phospholipid composition changes

    • Technology: Ion mobility-mass spectrometry for improved lipid isomer separation

    • Insight: Identification of specific acyl chain preferences and remodeling patterns

  • Cryo-electron microscopy:

    • Application: Determine the 3D structure of Lpcat2b alone and in complex with TLR4

    • Advantage: Visualize conformational changes upon activation

    • Impact: Guide structure-based drug design targeting Lpcat2b

  • Super-resolution microscopy:

    • Application: Track Lpcat2b dynamics in live cells during immune activation

    • Technology: PALM or STORM imaging of fluorescently tagged Lpcat2b

    • Insight: Visualize real-time translocation to membrane microdomains

These technologies will help resolve current knowledge gaps regarding the precise mechanisms by which Lpcat2b regulates inflammatory responses and membrane remodeling . The development of recombinant protein tools with specific tags and modifications will facilitate these advanced studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.