Recombinant Rat Lysoplasmalogenase (Tmem86b)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Rat Lysoplasmalogenase is typically expressed in Escherichia coli or mammalian systems (e.g., HEK 293T cells) for research applications:

Expression Systems

  • Bacterial: Expressed as a C-terminal GFP-His8 fusion protein in E. coli, followed by affinity chromatography and Tobacco Etch Virus protease cleavage .

  • Mammalian: Transient transfection of HEK 293T cells confirms functional activity and localization in membrane fractions .

Purification Protocols

  • Solubilized with octyl glucoside.

  • Multi-step chromatography (e.g., nickel-affinity, ion exchange) achieves ~500-fold purification .

Catalytic Activity

  • Substrates: Lysoplasmenylcholine and lysoplasmenylethanolamine.

  • Kinetic Parameters:

    • K<sub>m</sub>: ~50 µM for both substrates.

    • V<sub>max</sub>: 24.5 µmol/min/mg (choline) and 17.5 µmol/min/mg (ethanolamine) .

  • pH Optimum: 7.0 (rat liver enzyme) .

Inhibition

  • Competitively inhibited by lysophosphatidic acid (K<sub>i</sub> ≈ 20 µM) .

Specificity

  • No activity on diradyl plasmalogens, monoacyl glycerophospholipids, or 1-alkenyl-glycerol .

Mechanistic Studies

  • Overexpression in HEK 293T cells reduces cellular plasmalogen levels, confirming its role in lipid homeostasis .

  • Used to study lysoplasmalogen-induced membrane disruption and signaling pathways .

Assay Methods

  1. Coupled Enzyme Assay:

    • Measures NADH oxidation at 340 nm via yeast alcohol dehydrogenase coupling .

  2. Two-Dimensional TLC:

    • Quantifies substrate degradation and product formation (e.g., fatty aldehydes) .

Biological and Pathological Relevance

  • Disease Associations: Linked to peroxisomal disorders (e.g., rhizomelic chondrodysplasia punctata) and neurodegenerative conditions .

  • Physiological Role: Prevents lysoplasmalogen accumulation, which disrupts membrane integrity and Na<sup>+</sup>-K<sup>+</sup> ATPase activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem86b; Lysoplasmalogenase; Transmembrane protein 86B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem86b
Target Protein Sequence
MPCCDPYPWIGLNVGRLSSFPLLKYPQVRRWLAPFIVACSLYFLLWIPEDQPSWVSALVK CQPILCLVLFLWAVAPGGSYTWLLQGALTCSAVGDACLIWPEAFFYGMAVFSVAHLLYLW AFGLSPLQPGLLLCTTLASLTYYSFLLLHLEPNMVLPVAAYGLILNTMLWRGLVLGRSAG WGAVLFIFSDGVLAWDTFVYTLPFARLVTMSTYYAAQLLLTLSALRSPGLKTH
Uniprot No.

Target Background

Function
Recombinant Rat Lysoplasmalogenase (Tmem86b) is an enzyme that catalyzes the degradation of lysoplasmalogens. Lysoplasmalogens are formed by the hydrolysis of plasmalogens, abundant membrane glycerophospholipids. This enzyme may regulate cellular plasmalogen and lysoplasmalogen levels, thereby modulating cell membrane properties.
Database Links
Protein Families
TMEM86 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is rat lysoplasmalogenase (Tmem86b) and what is its primary function?

Rat lysoplasmalogenase (Tmem86b) is an enzyme that catalyzes the hydrolytic cleavage of the vinyl ether bond of lysoplasmalogen, which is the sn-2-deacylated form of plasmalogen. The enzyme belongs to the YhhN family of transmembrane proteins and plays a critical role in regulating plasmalogen levels in animal cells . Functionally, lysoplasmalogenase helps maintain the balance between plasmalogens and lysoplasmalogens, which is essential for preserving membrane stability and function. If lysoplasmalogen levels rise excessively, they may disrupt and lyse cell membranes; conversely, if levels are too low, transacylation reactions cannot occur, potentially disturbing membrane structure and function .

Methodologically, researchers can study the function of this enzyme through:

  • Monitoring vinyl ether bond cleavage by measuring the formation of glycerophosphoethanolamine, glycerophosphocholine, and fatty aldehydes

  • Assessing changes in plasmalogen levels in cellular systems with varied enzyme expression

  • Analyzing membrane stability and function in the presence of different lysoplasmalogen concentrations

What are the biochemical properties of recombinant rat lysoplasmalogenase?

The biochemical properties of recombinant rat lysoplasmalogenase include:

PropertyValue/Description
Substrate specificityActive on both lysoplasmenylcholine and lysoplasmenylethanolamine
Apparent Km values~50 μM for both lysoplasmenylcholine and lysoplasmenylethanolamine
Apparent Vmax24.5 μmol/min/mg protein (lysoplasmenylcholine) and 17.5 μmol/min/mg protein (lysoplasmenylethanolamine)
pH optimum7.0
InhibitorsCompetitively inhibited by lysophosphatidic acid (Ki ~20 μM)
Molecular weight~19 kDa
Subcellular localizationMembrane-associated, primarily in microsomes

When designing experiments, researchers should consider these biochemical parameters to optimize reaction conditions, especially maintaining pH at 7.0 and accounting for potential inhibition by lysophosphatidic acid .

How is recombinant rat lysoplasmalogenase (Tmem86b) typically expressed and purified?

Recombinant rat lysoplasmalogenase can be effectively expressed and purified using the following methodological approach:

Expression Systems:

  • Bacterial expression: Recombinant full-length rat lysoplasmalogenase (Tmem86b) protein (amino acids 1-233) can be successfully expressed in E. coli with N-terminal His tags .

  • Mammalian expression: The enzyme can also be expressed in human embryonic kidney (HEK) 293T cells for functional studies in a eukaryotic environment .

Purification Protocol:

  • For native enzyme from rat liver, solubilize microsomes with octyl glucoside

  • Employ a four-step chromatography purification process to achieve ~500-fold purification to near homogeneity

  • For recombinant His-tagged protein, use immobilized metal affinity chromatography (IMAC)

  • Verify purity by SDS-PAGE and Western blot analysis using anti-TMEM86B antibodies

  • Confirm activity using standard lysoplasmalogenase assays

Researchers should note that the membrane-associated nature of this protein may present challenges during purification and may require optimization of detergent conditions to maintain enzymatic activity.

What are the optimal storage conditions for recombinant rat lysoplasmalogenase?

While specific storage conditions for recombinant rat lysoplasmalogenase are not explicitly detailed in the provided search results, general recommendations for membrane-associated enzymes include:

Short-term Storage (1-2 weeks):

  • Store at 4°C in buffer containing:

    • 50 mM phosphate or Tris buffer, pH 7.0 (matching enzyme pH optimum)

    • 150 mM NaCl

    • 10% glycerol as a stabilizer

    • 0.05-0.1% mild detergent (such as octyl glucoside used in purification)

    • 1 mM DTT or 2-mercaptoethanol to prevent oxidation

Long-term Storage:

  • Store at -80°C in small aliquots to avoid freeze-thaw cycles

  • Add additional glycerol (up to 20%) as a cryoprotectant

  • Consider lyophilization for extended storage periods

Activity Retention:

  • Perform activity checks before experimental use

  • Monitor protein stability using enzyme assays described in the literature

  • Consider adding protease inhibitors to prevent degradation

Researchers should validate these conditions empirically for their specific recombinant protein preparation, as storage stability can vary depending on protein purity and formulation.

How can I verify the activity of recombinant rat lysoplasmalogenase in my experiments?

To verify the activity of recombinant rat lysoplasmalogenase, researchers can utilize two distinct assay methods that have been validated in the literature:

Method 1: Coupled Enzymatic Assay
This approach measures the formation of long-chain aldehydes produced by lysoplasmalogenase:

  • Incubate the enzyme with lysoplasmalogen substrate

  • Couple the reaction with alcohol dehydrogenase

  • Monitor NADH formation spectrophotometrically

  • Calculate activity based on the rate of NADH production

Method 2: Two-dimensional TLC Procedure
This method is particularly useful for stoichiometric studies and when using inhibitors that may interfere with coupled assays:

  • Incubate enzyme with substrate for varying time periods (0, 3, 8, and 16 min)

  • Stop the reaction by adding 12 ml of chloroform/methanol (2:1, v/v)

  • Isolate the lipid phase and concentrate under N₂

  • Apply to a 10 × 10-cm TLC plate

  • Develop using chloroform, methanol, ammonia (65:35:4) for both dimensions

  • Between dimensions, expose the plate to HCl vapor to cleave vinyl ether bonds

  • Quantify the disappearance of substrate and appearance of products

For activity verification, always include:

  • Positive controls (native enzyme or previously validated recombinant preparation)

  • Negative controls (heat-inactivated enzyme)

  • Substrate specificity controls (testing both lysoplasmenylcholine and lysoplasmenylethanolamine)

What are the structural features of rat lysoplasmalogenase (Tmem86b) and how do they relate to its enzymatic function?

While detailed structural information specifically for rat Tmem86b is limited in the provided search results, insights can be drawn from related proteins such as TMEM86A:

Predicted Structural Features:

  • Lysoplasmalogenase (Tmem86b) belongs to the YhhN family of transmembrane proteins

  • Based on homology with TMEM86A, it likely contains multiple transmembrane regions (potentially 8 transmembrane domains)

  • The protein is hydrophobic and primarily localized to membrane fractions, particularly microsomes

  • Critical catalytic residues are likely conserved aspartate residues, similar to D82 and D190 in TMEM86A, which when mutated reduce enzymatic activity

Structure-Function Relationships:

  • The membrane-embedded nature of the enzyme positions it optimally to access lysoplasmalogen substrates within the membrane

  • The hydrophobic transmembrane regions likely create a suitable environment for binding the hydrophobic portions of lysoplasmalogen

  • Conserved catalytic residues participate in the hydrolytic cleavage of the vinyl ether bond

Researchers investigating structure-function relationships should consider:

  • Conducting site-directed mutagenesis of conserved residues

  • Performing subcellular localization studies to confirm microsomal targeting

  • Exploring the impact of membrane composition on enzyme activity

  • Using computational modeling to predict substrate binding sites

How does lysoplasmalogenase regulate plasmalogen metabolism in different tissues?

Lysoplasmalogenase plays a tissue-specific role in regulating plasmalogen metabolism:

Tissue Distribution and Activity:

  • The liver expresses the highest levels of Tmem86b, which correlates with elevated lysoplasmalogenase activity

  • Small intestinal mucosa also shows high specific activity

  • Brain microsomes contain lower activity, approximately one-sixth of liver activity

  • A reciprocal relationship exists between plasmalogen content and lysoplasmalogenase activity across tissues

Metabolic Regulation:

  • Lysoplasmalogenase contributes to plasmalogen turnover by catabolizing lysoplasmalogen

  • This regulation is crucial since lysoplasmalogens are bioactive molecules that:

    • Can cause membrane-perturbing effects and cell lysis near their critical micelle concentration

    • Increase membrane fluidity and are involved in cell fusion

    • Cause circulating inflammatory cells to migrate to the endothelium

    • Activate cAMP-dependent protein kinase A, suggesting involvement in signal transduction

Experimental Design Considerations:
To study tissue-specific regulation, researchers should:

  • Compare enzyme activity across multiple tissues using standardized assays

  • Correlate enzyme levels with plasmalogen and lysoplasmalogen content

  • Investigate tissue-specific transcriptional regulation of the Tmem86b gene

  • Examine how physiological and pathological conditions affect expression in different tissues

What are the differences between TMEM86A and TMEM86B in terms of tissue expression and function?

While both TMEM86A and TMEM86B function as lysoplasmalogenases, they exhibit distinct tissue expression patterns and functional roles:

CharacteristicTMEM86ATMEM86B
Primary tissue expressionAdipose tissue (upregulated with high-fat diet) Liver (highest expression), small intestinal mucosa, brain (lower levels)
Response to metabolic conditionsUpregulated in diet-induced obesity and insulin resistance Not specifically reported to respond to diet in the search results
Physiological impact when knocked outIncreases oxidative metabolism in adipose tissues, improves systemic metabolism, protects from metabolic dysfunction induced by high-fat diet Not reported in the search results
Molecular pathways affectedPotentiates PKA signaling by inhibiting phosphodiesterase 3B (PDE3B) Regulates balance between plasmalogen and lysoplasmalogen levels
Effect on gene expression when knocked outUpregulates thermogenic genes (Ppargc1a, Ucp1, Cox8b, Dio2) Not reported in the search results

Methodological Approach to Study Differences:

  • Compare substrate specificity and kinetic parameters using purified recombinant proteins

  • Conduct tissue-specific knockout studies to elucidate distinct physiological roles

  • Perform transcriptomic and proteomic analyses of tissues from wild-type and knockout models

  • Investigate potential compensatory mechanisms between the two proteins

These differences suggest complementary roles in regulating plasmalogen metabolism across different tissues and metabolic states.

How can I design experiments to study the impact of lysoplasmalogenase overexpression or knockdown on cellular plasmalogen levels?

Designing robust experiments to study the impact of lysoplasmalogenase manipulation requires careful consideration of multiple factors:

Overexpression Studies:

  • Experimental System:

    • Use HEK 293T cells for transient transfection of Tmem86b cDNA

    • Confirm overexpression by Western blot analysis

    • Verify subcellular localization using cell fractionation or immunofluorescence

  • Control Conditions:

    • Empty vector transfection

    • Overexpression of catalytically inactive mutant (based on conserved residues)

    • Time-course to monitor expression stability

  • Analytical Methods:

    • Global phospholipid profiling to detect changes in multiple lipid species

    • Principal component analysis (PCA) to distinguish treatment groups

    • Quantification of plasmalogen and lysoplasmalogen levels using LC-MS

Knockdown/Knockout Studies:

  • Approach Options:

    • siRNA/shRNA for transient or stable knockdown

    • CRISPR-Cas9 for complete gene knockout

    • Tissue-specific knockout using Cre-loxP system (as demonstrated with TMEM86A)

  • Validation Methods:

    • RT-qPCR to confirm reduced mRNA expression

    • Western blot to verify protein reduction

    • Enzyme activity assays to confirm functional impact

  • Phenotypic Assessments:

    • Measure plasmalogen levels using mass spectrometry

    • Assess membrane stability and fluidity

    • Monitor cellular functions dependent on membrane integrity

Expected Outcomes Based on Literature:

  • Overexpression of TMEM86B in HEK 293T cells results in decreased levels of plasmalogens

  • By analogy with TMEM86A studies, knockout may lead to increased plasmalogen levels and altered cellular metabolism

What analytical methods are recommended for quantifying lysoplasmalogenase activity in biological samples?

Several complementary analytical methods can be employed to quantify lysoplasmalogenase activity in biological samples:

1. Spectrophotometric Coupled Enzyme Assay:

  • Principle: Measures formation of aldehydes using alcohol dehydrogenase and NAD+

  • Advantages: Continuous monitoring, suitable for high-throughput screening

  • Limitations: Potential interference from other NAD+-consuming reactions

  • Sample Types: Purified enzyme, cell lysates, tissue homogenates

2. Two-dimensional TLC Method:

  • Protocol:

    • Incubate sample with lysoplasmalogen substrate for defined time periods

    • Stop reaction with chloroform/methanol (2:1, v/v)

    • Isolate lipid phase and apply to TLC plate

    • Develop using chloroform, methanol, ammonia (65:35:4) solvent system

    • Expose to HCl vapor between dimensions

    • Develop second dimension and quantify spots

  • Advantages: Allows detection of multiple reaction products, useful with inhibitors that affect coupling enzymes

  • Limitations: Labor-intensive, semi-quantitative, requires radioactive substrates for optimal sensitivity

3. LC-MS Analysis:

  • Approach: Challenge samples with lysoplasmalogen substrates (e.g., LPE P-18:0) and measure substrate consumption and product formation

  • Quantification: Calculate catalytic activity by determining the difference between initial substrate levels and residual substrate in the conditioned media

  • Advantages: High sensitivity and specificity, can identify multiple lipid species simultaneously

  • Applications: Ideal for complex biological samples and detailed substrate specificity studies

Data Analysis Considerations:

  • Use appropriate enzyme kinetics models to determine Km and Vmax values

  • Account for background activity in negative controls

  • Consider time-dependent changes in activity, especially with crude samples

  • Validate results using multiple methods when possible

How can recombinant rat lysoplasmalogenase be used as a tool to study plasmalogen metabolism disorders?

Recombinant rat lysoplasmalogenase represents a valuable tool for investigating plasmalogen metabolism disorders through several experimental approaches:

1. In Vitro Disease Modeling:

  • Substrate Processing Analysis:

    • Compare the enzyme's ability to process normal vs. disease-associated lysoplasmalogen species

    • Determine kinetic parameters for different substrates relevant to specific disorders

    • Assess the impact of disease-relevant conditions (pH, oxidative stress) on enzyme activity

  • Metabolite Profiling:

    • Use the recombinant enzyme to generate reference metabolites for analytical method development

    • Create standards for quantifying disease-specific lipid intermediates

    • Develop enzymatic assays to detect abnormal plasmalogen metabolism in patient samples

2. Cell-Based Disease Models:

  • Complementation Studies:

    • Introduce recombinant lysoplasmalogenase into cells from patients with plasmalogen disorders

    • Assess rescue of cellular phenotypes by measuring plasmalogen restoration

    • Study compensatory mechanisms in response to enzyme supplementation

  • Physiological Impact:

    • Investigate how altered enzyme levels affect membrane properties

    • Monitor changes in signaling pathways influenced by lysoplasmalogen levels

    • Assess cellular responses to stress under different enzyme expression conditions

3. Therapeutic Development:

  • Enzyme Modification:

    • Engineer enhanced stability or activity variants for potential enzyme replacement therapy

    • Develop cell-penetrating versions of the enzyme for research applications

    • Create inhibitors based on enzyme structure to modulate plasmalogen metabolism

  • Biomarker Discovery:

    • Use enzymatic assays to identify novel biomarkers in plasmalogen disorders

    • Develop diagnostic tools based on substrate processing efficiency

    • Create high-throughput screening platforms for drug discovery

The known bioactive properties of lysoplasmalogens, including their effects on membrane fluidity, cell fusion, inflammatory cell migration, and signal transduction , make this enzyme particularly relevant for studying disorders with membrane dysfunction components.

What are the key residues involved in the catalytic activity of lysoplasmalogenase and how might targeted mutations affect its function?

While specific information about key catalytic residues in rat Tmem86b is limited in the provided search results, insights can be drawn from related proteins:

Key Catalytic Residues:

  • Based on TMEM86A studies, conserved aspartate residues (analogous to D82 and D190 in TMEM86A) are likely critical for lysoplasmalogenase activity

  • These residues are absolutely conserved between bacterial and mammalian YhhN lysoplasmalogenases

  • Computational models suggest juxtaposition of potential catalytic histidine and aspartate residues within the transmembrane region

Effects of Targeted Mutations:

  • Mutation of D82A or D190A in TMEM86A significantly reduces lysoplasmalogenase activity

  • By analogy, similar mutations in TMEM86B would likely impair catalytic function

  • These findings suggest an essential role for these aspartate residues in the enzyme's mechanism

Rational Mutagenesis Approach:
Drawing from related enzyme studies, researchers could:

  • Perform multiple sequence alignments of YhhN family members to identify additional conserved residues

  • Generate point mutations of potential catalytic residues

  • Assess kinetic parameters (Km, Vmax) of mutant enzymes

  • Examine substrate specificity changes in response to mutations

Substrate Specificity Engineering:
The study on lysoplasmalogen-specific phospholipase D (LyPls-PLD) provides insights into substrate specificity modification:

  • The F211L mutation in LyPls-PLD substantially altered substrate preference, increasing the LysoPAF/LyPlsCho activity ratio by 25-fold

  • This suggests that targeted mutagenesis could similarly modify TMEM86B substrate preferences

  • Key residues, including those equivalent to A47, M71, N173, F211, and W282 in LyPls-PLD, may be involved in substrate recognition

Structure-Function Considerations:

  • Product release appears to be the rate-limiting step in related enzymes

  • The flexibility of the sn-1 ether-linked vinyl/alkyl chain is essential for substrate binding and product release

  • Mutations affecting the substrate binding pocket could therefore impact not only substrate recognition but also product release kinetics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.