Recombinant Rat Lysosomal-associated transmembrane protein 4B (Laptm4b)

Shipped with Ice Packs
In Stock

Description

Recombinant Rat Lysosomal-associated Transmembrane Protein 4B (Laptm4b): Structure, Function, and Research Applications

LAPTM4B is a critical lysosomal membrane protein that plays multiple roles in cellular processes including lysosomal function, membrane trafficking, autophagy, and apoptosis. Research has revealed its involvement in numerous pathological conditions, particularly in cancer, cardiovascular diseases, and immune regulation. Recent findings suggest that LAPTM4B functions as both a structural component of lysosomes and a regulatory protein in multiple signaling pathways, making it an important target for research and potential therapeutic interventions. This review comprehensively examines recombinant rat LAPTM4B, including its molecular properties, biological functions, pathological implications, and current research applications.

Protein Structure and Localization

LAPTM4B is a multi-pass membrane protein primarily located in the endomembrane system, particularly within the lysosomal membrane . Structurally, it contains several transmembrane domains that anchor it to the lysosomal membrane, with the protein exhibiting molecular weight variations due to different isoforms. The observed molecular weight of LAPTM4B is approximately 37kDa, while calculated molecular weights range from 25kDa to 41kDa depending on post-translational modifications and specific isoforms .

The protein contains specific functional domains, including an extracellular (EC3) domain that mediates interactions with other proteins such as mammalian target of rapamycin (mTOR) . This structural feature is critical for LAPTM4B's role in regulating various cellular pathways and processes.

Gene Expression and Regulation

In rats, LAPTM4B expression is tissue-specific, with significant expression observed in various tissues including the heart, where it plays a crucial role in cardiac function and protection against ischemia/reperfusion injury . Interestingly, LAPTM4B expression is differentially regulated under various pathological conditions. For instance, it is downregulated in ischemia/reperfusion heart models and hypoxia/reoxygenation cardiomyocytes, contributing to the pathogenesis of cardiac injury .

Within the immune system, LAPTM4B is expressed at higher levels in regulatory T cells (Tregs) compared to helper T cells (Th), suggesting its role in immune regulation . This differential expression pattern indicates that LAPTM4B may serve as a potential biomarker for various disease states and cellular conditions.

Role in Lysosomal Function

LAPTM4B is essential for optimal lysosomal function, serving as a key component of the lysosomal membrane . It contributes to the maintenance of lysosomal integrity and participates in the regulation of lysosomal enzyme activity. The protein's presence in lysosomes is critical for proper cellular degradation processes and waste removal.

Additionally, LAPTM4B recruits specific transporters, including SLC3A2 and SLC7A5 (the leucine transporter), to the lysosomal membrane . This recruitment promotes the entry of leucine and other essential amino acids into the lysosome, stimulating the activation of the proton-transporting vacuolar ATPase protein pump (V-ATPase), which subsequently leads to mTORC1 activation . This function positions LAPTM4B as a crucial regulator of nutrient sensing and cellular metabolism.

Regulation of Autophagic Flux

One of the most significant functions of LAPTM4B is its involvement in autophagic flux regulation. Research has shown that LAPTM4B contributes to myocardial ischemia/reperfusion injury and protection by modulating autophagic flux through its effects on autophagosome clearance . Specifically, LAPTM4B suppresses the activation of mTORC1 by directly interacting with mTOR through its EC3 domain .

Furthermore, LAPTM4B maintains the activity of transcription factor EB (TFEB), which subsequently promotes autophagic flux in cardiomyocytes . This regulatory mechanism is particularly important in the context of cellular stress responses, where autophagy serves as a protective mechanism to maintain cellular homeostasis.

Involvement in Membrane Trafficking

LAPTM4B plays a significant role in membrane trafficking processes, particularly in the regulation of epidermal growth factor receptor (EGFR) sorting and degradation. It blocks EGF-stimulated EGFR intraluminal sorting and degradation, thereby influencing cellular signaling pathways associated with growth and proliferation .

Additionally, LAPTM4B regulates phosphatidylinositol 4,5-bisphosphate interactions with PIP5K1C, which inhibits HGS ubiquitination and relieves LAPTM4B inhibition of EGFR degradation . This complex regulatory mechanism highlights LAPTM4B's role in fine-tuning membrane receptor dynamics and signaling.

Immune System Regulation

In the immune system, LAPTM4B serves as a negative regulator of transforming growth factor beta 1 (TGF-β1) production in regulatory T cells . LAPTM4B interacts with glycoprotein A repetitions predominant (GARP) in mammalian cells, decreasing the cleavage of proTGF-β1, secretion of soluble latent TGF-β1, and surface presentation of GARP·TGF-β1 complexes .

This regulatory function has significant implications for immune responses, as TGF-β1 produced by regulatory T cells is known to suppress excessive immune responses . By inhibiting TGF-β1 production, LAPTM4B may play a role in modulating immunosuppression by Tregs, potentially influencing autoimmune conditions and immune responses to cancer.

Cardiovascular Diseases

LAPTM4B has emerged as a critical factor in cardiovascular disease pathogenesis, particularly in the context of myocardial ischemia/reperfusion injury. Research has demonstrated that LAPTM4B is downregulated in ischemia/reperfusion heart models and hypoxia/reoxygenation cardiomyocytes . This downregulation correlates with the impairment of autophagic flux, which exacerbates cardiomyocyte death during myocardial ischemia/reperfusion injury .

Conversely, overexpression of LAPTM4B has been shown to protect the heart from ischemia/reperfusion injury by promoting autophagic flux through the restoration of impaired autophagosome clearance . These findings suggest that LAPTM4B could be a potential therapeutic target for cardioprotection in the context of ischemic heart disease and other cardiovascular conditions.

Cancer

Dysregulation of LAPTM4B has been linked to various types of cancer, making it a valuable biomarker for cancer research and potential therapeutic interventions . While the specific mechanisms of LAPTM4B involvement in cancer progression are still being elucidated, its roles in lysosomal function, membrane trafficking, and autophagy regulation likely contribute to its oncogenic potential.

The ability of LAPTM4B to regulate EGFR degradation and influence cellular signaling pathways associated with growth and proliferation may be particularly relevant to its role in cancer development and progression . Additionally, its involvement in ceramide binding and transport from late endosomes to control cell death pathways further implicates LAPTM4B in cancer cell survival mechanisms .

Immune System Disorders

Given its role in regulating TGF-β1 production in regulatory T cells, LAPTM4B may be implicated in various immune system disorders. By binding to GARP and negatively regulating TGF-β1 production, LAPTM4B may influence the balance of immune responses, potentially affecting conditions characterized by immune dysregulation .

Research has shown that LAPTM4B is expressed at higher levels in Tregs compared to helper T cells, suggesting its specific role in the function of these immunosuppressive cells . This differential expression and functional role position LAPTM4B as a potential therapeutic target for modulating immunosuppression by Tregs in the context of autoimmune diseases, cancer immunotherapy, and transplantation.

ELISA Kits for LAPTM4B Detection

The Rat Lysosomal-Associated Transmembrane Protein 4B (LAPTM4B) ELISA Kit has been developed as a reliable and accurate tool for detecting LAPTM4B levels in rat samples . This kit offers high sensitivity and specificity, making it valuable for researchers investigating LAPTM4B's role in various biological processes and disease states.

The ELISA kit specifications are summarized in the following table:

ParameterSpecification
Assay TypeSandwich ELISA
Detection Range0.156-10 ng/mL
Sensitivity0.078 ng/mL
Sample TypesSerum, plasma, tissue homogenates, cell culture supernatants
SpecificityNatural and recombinant rat LAPTM4B
Research AreaCancer, cardiovascular research, immunology
UniprotQ5U1W4

This ELISA kit provides researchers with a valuable tool for quantitatively assessing LAPTM4B levels in various experimental settings, facilitating investigations into its role in disease pathogenesis and potential therapeutic applications .

Antibodies for LAPTM4B Research

Various antibodies have been developed for LAPTM4B research, including the LAPTM4B Rabbit polyclonal antibody (pAb) . These antibodies provide essential tools for studying LAPTM4B expression, localization, and interactions with other proteins.

The LAPTM4B Rabbit pAb has demonstrated specificity for human, mouse, and rat LAPTM4B, making it suitable for cross-species research applications . It is particularly useful for western blot analysis, allowing researchers to detect LAPTM4B expression levels in various cell lines and tissue samples.

Recombinant LAPTM4B in Experimental Models

Recombinant rat LAPTM4B has been used in various experimental models to investigate its functions and potential therapeutic applications. In myocardial ischemia/reperfusion models, recombinant LAPTM4B overexpression has demonstrated cardioprotective effects through the enhancement of autophagic flux .

Similarly, in immune cell models, recombinant LAPTM4B has been employed to study its interactions with GARP and effects on TGF-β1 production in regulatory T cells . These experimental applications highlight the versatility of recombinant LAPTM4B as a research tool for understanding its biological functions and pathological implications.

LAPTM4B in Cardiovascular Research

Recent studies have uncovered the role of LAPTM4B in myocardial ischemia/reperfusion injury and protection through its regulation of autophagic flux. Using myocardial ischemia/reperfusion mouse models and hypoxia/reoxygenation cardiomyocyte models, researchers have demonstrated that LAPTM4B is downregulated during ischemia/reperfusion and hypoxia/reoxygenation, contributing to the impairment of autophagic flux .

Further investigations have revealed that LAPTM4B suppresses the activation of mTORC1 by interacting with mTOR through its EC3 domain, subsequently maintaining TFEB activity and promoting autophagic flux in cardiomyocytes . This mechanism provides cardioprotection by enhancing autophagosome clearance, which is impaired during ischemia/reperfusion injury.

These findings suggest that strategies aimed at preserving or enhancing LAPTM4B expression during ischemia/reperfusion could offer cardioprotective benefits, potentially leading to new therapeutic approaches for ischemic heart disease.

LAPTM4B in Immune Regulation

Research focusing on LAPTM4B's role in immune regulation has identified it as a negative regulator of TGF-β1 production in regulatory T cells. Through yeast two-hybrid assays and mammalian cell studies, LAPTM4B has been shown to interact with GARP, a transmembrane protein specifically expressed on stimulated Tregs .

These findings have significant implications for understanding the regulation of immune responses, particularly in contexts where Treg-mediated immunosuppression plays a critical role, such as autoimmune diseases, cancer, and transplantation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Laptm4b; Lysosomal-associated transmembrane protein 4B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Laptm4b
Target Protein Sequence
MKMVAPWTRFYSHSCCLCCHVRTGTILLGIWYLIINAVVLLILLSALADPDQYHFSGSEL GGEFEFMDDANMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAI TVLVYPNSIQEYIRQLPPSFPYRDDIMSVNPTCLVLVILLFIGIILTFKGYLISCVWSCY RYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVTGTAKEPPPPYVSA
Uniprot No.

Target Background

Function
Lysosomal-associated transmembrane protein 4B (LAPTM4B) is crucial for optimal lysosomal function. It inhibits EGF-stimulated EGFR intraluminal sorting and degradation. By binding to phosphatidylinositol 4,5-bisphosphate (PIP2), it regulates PIP5K1C interaction, inhibiting HGS ubiquitination and alleviating LAPTM4B inhibition of EGFR degradation. LAPTM4B recruits SLC3A2 and SLC7A5 (the Leu transporter) to the lysosome, promoting the entry of leucine and other essential amino acids (EAAs) into the lysosome. This stimulation activates the proton-transporting vacuolar (V)-ATPase protein pump (V-ATPase) and subsequently mTORC1. LAPTM4B functions as a negative regulator of TGFB1 production in regulatory T cells. It binds ceramide and facilitates its exit from the late endosome, thereby controlling cell death pathways.
Database Links
Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Endomembrane system; Multi-pass membrane protein. Late endosome membrane. Cell membrane. Cell projection. Lysosome membrane. Endosome membrane. Endosome, multivesicular body membrane. Endosome, multivesicular body lumen.

Q&A

What is rat Laptm4b and how does it function in cellular processes?

Laptm4b (Lysosomal-associated transmembrane protein 4B) is a glycoprotein with four to five transmembrane domains that belongs to a family of three related proteins, including Laptm4a and Laptm5. The protein plays multiple roles in cellular processes, with its primary location being in lysosomal and endosomal membranes. In immune cells, particularly regulatory T cells (Tregs), Laptm4b acts as a negative regulator of TGF-β1 production by interacting with glycoprotein A repetitions predominant (GARP) . This interaction inhibits the cleavage of proTGF-β1, reduces secretion of latent TGF-β1, and decreases surface presentation of GARP·latent TGF-β1 complexes on the cell surface . Additionally, Laptm4b has been identified to have oncogenic functions in various tumor cells, promoting proliferation, migration, invasion, and metastasis through mechanisms involving the EGF receptor signaling pathway . Understanding these dual functions in immune regulation and oncogenesis is essential for researchers designing experiments to characterize rat Laptm4b.

What are the known isoforms of rat Laptm4b and how do they differ functionally?

Based on research primarily from human studies, multiple isoforms of Laptm4b exist with different molecular weights and potentially distinct functions. In humans, three main isoforms have been identified: Laptm4b iso35, Laptm4b iso24, and Laptm4b iso20 . The rat homologs likely follow similar patterns. These isoforms result from alternative mRNA splicing, with two primary mRNA variants (referred to as Va and Vb) being expressed at different levels in various cell types .

The functional differences between these isoforms involve their ability to interact with partner proteins. For example, research on human Laptm4b has shown that Laptm4b iso20 can interact with GARP even without the 66 N-terminal amino acids present in Laptm4b iso24 . This suggests that different domains within the protein contribute differently to its various functions. Researchers working with rat Laptm4b should design experiments that can distinguish between these isoforms, as their distribution and relative abundance may vary across different tissues and cell types, potentially leading to context-specific functions.

How is Laptm4b expression regulated in different rat tissues and cell types?

Laptm4b expression varies significantly across different tissues and cell types, with particular patterns observed in immune cells. In regulatory T cells (Tregs), Laptm4b expression is upregulated following T cell receptor (TCR) activation . Studies of human Laptm4b have shown that expression levels of specific variants (Va and Vb) are higher in Tregs compared to helper T cells (Th cells), both at rest and after stimulation .

The regulation involves transcriptional control mechanisms that respond to cellular activation signals. For instance, in human Tregs, the Va variant is expressed at higher levels than Vb in both Tregs and Th cells, but Va expression was significantly higher in Treg than in Th clones (approximately 1.9-fold higher at rest and 2.7-fold higher after stimulation) . The Vb variant was only detectable at significant levels in stimulated Treg clones . When investigating rat Laptm4b, researchers should employ quantitative approaches such as RT-qPCR with variant-specific primers to accurately measure expression patterns across different tissues and under various stimulation conditions.

How conserved is Laptm4b across species, and what implications does this have for translational research?

Laptm4b belongs to a family that includes Laptm4a and Laptm5, with sequence identities of approximately 46% and 23% respectively in humans . While the search results don't provide specific information about cross-species conservation, the functional roles of Laptm4b in fundamental cellular processes suggest considerable conservation across mammalian species, including between humans and rats. This conservation likely extends to key functional domains, interaction interfaces, and regulatory mechanisms.

What are the recommended methods for detecting and quantifying Laptm4b expression in rat samples?

Several complementary approaches are recommended for detecting and quantifying Laptm4b expression in rat samples, each with specific advantages for particular research questions.

For mRNA detection and quantification, RT-PCR and RT-qPCR are the methods of choice. These techniques require careful primer design to distinguish between different mRNA variants. Based on human studies, researchers should design primers that can discriminate between potential variants similar to human Va and Vb . For RT-qPCR, normalization against stable reference genes such as EF-1 (as used in human studies) is crucial for accurate quantification .

For example, in human studies, the following primer strategies were employed:

  • For variant-specific RT-PCR: primers A1, A2, B, and R targeting different regions of the transcript

  • For RT-qPCR of Va: sense primer (5'-ACCATCCTGCTCGGCGTCTG-3'), antisense primer (5'-CGGATCAGCCAGGGCACTCAAT-3')

  • For RT-qPCR of Vb: sense primer (5'-GCTCTATGGTGCCTGGGCCA-3'), antisense primer (5'-CGGATCAGCCAGGGCACTCAAT-3'), and a FAM-TAMRA TaqMan probe (5'-GTACCACAGCATTGATGATCTCATTCCCC-3')

For protein detection, Western blotting using specific antibodies against rat Laptm4b is effective for identifying different isoforms based on molecular weight. Flow cytometry can be used to assess surface or intracellular Laptm4b levels in single cells, while immunohistochemistry or immunofluorescence allows visualization of Laptm4b localization within tissues or cells. When studying protein-protein interactions, co-immunoprecipitation or protein complementation assays (such as the luciferase-based system described for human Laptm4b and GARP) can be employed .

How can recombinant rat Laptm4b be efficiently produced and purified for functional studies?

Production of recombinant rat Laptm4b presents challenges common to multi-pass transmembrane proteins. A systematic approach involves:

  • Expression system selection: For full-length Laptm4b with native conformation, mammalian expression systems (HEK293 or CHO cells) are preferred. For specific domains or partial constructs, bacterial (E. coli) or insect cell (Sf9) systems may be suitable.

  • Construct design: Based on the human studies, researchers should consider creating constructs for specific isoforms (similar to iso20 and iso24) with appropriate epitope or purification tags (e.g., HA, FLAG, or His6) . When designing constructs, attention must be paid to the transmembrane topology to ensure tags are accessible.

  • Expression optimization: For mammalian systems, transient transfection followed by stable cell line generation with optimized expression conditions is recommended. The human studies utilized transfected 293T cells successfully for Laptm4b expression .

  • Purification strategy: Detergent solubilization (e.g., with n-dodecyl-β-D-maltoside or digitonin) followed by affinity chromatography based on the incorporated tag. For membrane proteins like Laptm4b, maintaining protein stability during purification is critical.

  • Validation: The purified protein should be validated for proper folding and function through biochemical assays such as circular dichroism or protein-protein interaction studies with known partners like GARP .

For functional studies not requiring purified protein, researchers can use cell lines transiently or stably expressing recombinant rat Laptm4b, as demonstrated in human studies with 293T cells expressing LAPTM4B constructs .

What experimental approaches are most effective for studying Laptm4b interactions with other proteins?

Several complementary techniques have proven effective for investigating protein-protein interactions involving Laptm4b:

  • Yeast two-hybrid screening: This approach was successfully used to identify LAPTM4B as an interaction partner of GARP in human Tregs . For rat studies, constructing a rat Treg cDNA library and using rat Laptm4b as bait could identify species-specific interaction partners.

  • Protein complementation assays: The humanized Gaussia luciferase complementation assay described in the human studies provides a sensitive method for confirming interactions in mammalian cells . In this system, inactive fragments of luciferase (hGLuc1 and hGLuc2) are fused to candidate proteins, with luciferase activity recovered only when proteins interact. This approach successfully demonstrated the interaction between human GARP and LAPTM4B isoforms .

  • Co-immunoprecipitation: This traditional approach remains valuable for confirming interactions under near-physiological conditions. For Laptm4b studies, epitope-tagged constructs (e.g., HA-tagged as used in the human studies) facilitate efficient precipitation and detection .

  • Confocal microscopy and colocalization analysis: Fluorescently tagged Laptm4b and candidate interacting proteins can be expressed in cells to visualize potential colocalization, providing insights into the subcellular compartments where interactions occur.

  • Proximity ligation assays: This technique can detect protein interactions in situ in fixed cells or tissues with high sensitivity and specificity, offering advantages for studying Laptm4b interactions in their native context.

When designing interaction studies, researchers should consider the transmembrane nature of Laptm4b and ensure that the approaches used preserve the native conformation of the protein.

What genetic manipulation techniques are most suitable for studying rat Laptm4b function?

Several genetic manipulation approaches are suitable for investigating rat Laptm4b function:

  • RNA interference (RNAi): siRNA or shRNA targeting Laptm4b can effectively reduce expression levels, as demonstrated in human studies . When designing RNAi approaches, researchers should consider:

    • Target specificity to avoid off-target effects

    • Targeting sequences common to all variants or specific to individual variants

    • Appropriate controls including non-targeting sequences

    • Validation of knockdown efficiency at both mRNA and protein levels

  • CRISPR-Cas9 gene editing: This approach offers advantages for complete knockout or for introducing specific mutations:

    • Complete knockout to study loss-of-function effects

    • Knock-in of tagged versions for tracking endogenous protein

    • Introduction of domain-specific mutations to study structure-function relationships

    • Generation of isoform-specific knockouts

  • Overexpression systems: As used in the human studies with 293T cells, overexpression of wild-type or mutant Laptm4b constructs can reveal gain-of-function effects and domain-specific functions . Considerations include:

    • Inducible expression systems to control expression timing and level

    • Isoform-specific constructs to distinguish functions

    • Fusion with fluorescent reporters for localization studies

    • Epitope tagging for interaction and localization studies

  • Animal models: For in vivo studies, consider:

    • Conditional knockout models using Cre-loxP systems for tissue-specific deletion

    • Transgenic overexpression models for gain-of-function studies

    • Knockin models for studying specific mutations or tagged versions

Each approach has advantages depending on the specific research question, with combinations often providing the most comprehensive insights into protein function.

How does rat Laptm4b modulate TGF-β1 signaling in immune cells?

Laptm4b serves as a negative regulator of TGF-β1 production in regulatory T cells through multiple mechanisms affecting the TGF-β1 processing pathway. Based on studies of human LAPTM4B, this modulation occurs through direct interaction with GARP, a receptor for latent TGF-β1 expressed on stimulated Tregs .

The modulatory effects occur at several levels:

  • Inhibition of proTGF-β1 cleavage: LAPTM4B decreases the GARP-induced cleavage of proTGF-β1 into latent inactive TGF-β1, as demonstrated by Western blot analysis in transfected cells . This represents an early regulatory step in TGF-β1 production.

  • Reduction of latent TGF-β1 secretion: ELISA measurements of culture supernatants from cells expressing LAPTM4B showed decreased levels of secreted latent TGF-β1 . This effect was observed both in the presence and absence of GARP, suggesting multiple mechanisms may be involved.

  • Decreased surface presentation of GARP·latent TGF-β1 complexes: Flow cytometry analysis revealed that LAPTM4B reduces surface levels of both GARP (by 67%) and LAP (by 73%) in cells expressing both GARP and TGF-β1 . This effect appears to be specific, as surface levels of unrelated proteins like HLA-A2 or CD9 were not affected.

  • No direct effect on TGF-β1 activation: Reporter assays using a CAGA-LUC construct responsive to SMAD2/3 activation showed that LAPTM4B does not activate latent TGF-β1, either alone or in cooperation with GARP .

For researchers studying rat Laptm4b, similar experimental approaches (Western blotting, ELISA, flow cytometry, and reporter assays) would be effective for investigating whether these regulatory mechanisms are conserved across species. Additionally, examining downstream effects on SMAD signaling and TGF-β1-responsive genes would provide insights into the functional consequences of Laptm4b-mediated regulation in rat immune cells.

What are the molecular mechanisms underlying Laptm4b's oncogenic functions in rat tumor models?

While the search results focus primarily on LAPTM4B's immune functions, they also reference its oncogenic roles in human cancers. For rat tumor models, researchers should investigate similar mechanisms, particularly those involving receptor trafficking and signaling pathways.

Based on human studies, two key mechanisms contribute to LAPTM4B's oncogenic functions:

  • Enhancement of EGF receptor signaling: In the presence of EGF, LAPTM4B blocks lysosomal degradation of activated EGF receptor, prolonging signaling duration . This mechanism likely involves LAPTM4B's location in endosomal and lysosomal compartments, where it may interfere with receptor sorting or degradation machinery.

  • Promotion of cell-protective autophagy: In the absence of EGF, LAPTM4B interacts with inactive EGF receptor in endosomes to initiate autophagy, promoting cell survival under stress conditions .

For researchers investigating rat Laptm4b in tumor models, several experimental approaches are recommended:

  • Comparative expression analysis: Quantify Laptm4b expression levels across normal tissues and tumor samples using RT-qPCR and immunohistochemistry to establish correlations with tumor aggressiveness and clinical outcomes.

  • Functional assays following genetic manipulation: Measure proliferation, migration, invasion, and resistance to apoptosis in rat tumor cell lines with Laptm4b knockdown or overexpression.

  • Receptor trafficking studies: Use fluorescently labeled receptors (particularly EGFR) combined with Laptm4b manipulation to track receptor internalization, recycling, and degradation kinetics.

  • Signaling pathway analysis: Evaluate the impact of Laptm4b manipulation on key oncogenic signaling pathways (MAPK/ERK, PI3K/AKT) using phospho-specific antibodies and reporter assays.

  • In vivo models: Develop orthotopic or xenograft models with Laptm4b-manipulated tumor cells to assess effects on tumor growth, metastasis, and response to therapy.

These approaches will help determine whether the oncogenic mechanisms of rat Laptm4b parallel those identified in human studies and may reveal species-specific aspects of its function.

How do the different domains of rat Laptm4b contribute to its various functions?

Understanding the structure-function relationships of Laptm4b domains requires systematic analysis through mutational and domain-swapping approaches. Based on information from human studies, several key domains likely contribute to different functions:

  • N-terminal domain: The first 66 amino acids present in LAPTM4B iso24 but absent in LAPTM4B iso20 are not required for interaction with GARP, as demonstrated in protein complementation assays . This suggests that the N-terminal region may serve other functions, possibly related to trafficking or interactions with other partners.

  • Transmembrane domains: As a multi-pass membrane protein, Laptm4b contains four or five transmembrane domains that anchor it in cellular membranes. These domains likely define the protein's topology and may contribute to its localization in specific cellular compartments.

  • C-terminal polyproline-tyrosine (PY) motifs: These motifs, similar to those in related protein Laptm5, may target Laptm4b to lysosomes . In Laptm5, these motifs are required for downmodulation of surface receptor levels, suggesting a mechanism by which Laptm4b might also regulate surface GARP levels .

  • Interaction interfaces: Specific residues or regions involved in protein-protein interactions, such as the GARP-binding interface, represent functional domains that could be mapped through targeted mutagenesis.

To investigate these domains in rat Laptm4b, researchers should consider:

  • Creating a panel of truncation and deletion mutants focusing on predicted functional domains

  • Generating chimeric proteins that swap domains between Laptm4b and related family members

  • Performing site-directed mutagenesis of conserved residues within each domain

  • Using these mutants in functional assays measuring protein-protein interactions, subcellular localization, and effects on TGF-β1 processing or receptor trafficking

These approaches will help establish which domains are necessary and sufficient for specific functions, providing insights into the molecular mechanisms underlying Laptm4b's diverse roles.

What is the relationship between Laptm4b's functions in immune regulation and its oncogenic properties?

The dual roles of Laptm4b in immune regulation and oncogenesis represent an intriguing area for investigation. Based on the search results, several hypotheses and research directions emerge:

Experimental approaches to explore these relationships include:

  • Comparative analysis of Laptm4b expression and function in tumor cells and tumor-infiltrating lymphocytes from the same samples

  • Investigation of how Laptm4b expression in tumor cells affects their response to TGF-β1 signaling

  • Analysis of immune responses against tumors with manipulated Laptm4b expression

  • Evaluation of how Laptm4b expression in immune cells affects anti-tumor immunity and tumor growth in vivo

These studies would provide insights into whether Laptm4b's immune and oncogenic functions represent distinct roles or interconnected aspects of its cellular function.

How should researchers address inconsistent results in Laptm4b expression studies?

Inconsistent results in Laptm4b expression studies can arise from several sources. Researchers should systematically address these issues through the following approaches:

  • Isoform-specific detection: Different Laptm4b isoforms may show distinct expression patterns. Ensure that detection methods (primers, antibodies) can distinguish between variants. For RT-qPCR, use variant-specific primers similar to those described for human LAPTM4B variants (Va and Vb) . For Western blotting, use antibodies that can detect all relevant isoforms or isoform-specific antibodies as needed.

  • Cell activation state considerations: Laptm4b expression can be activation-dependent. In human Tregs, LAPTM4B levels increase following TCR stimulation . When comparing expression across samples, ensure consistent activation states or explicitly account for activation as a variable.

  • Technical validation:

    • For RT-qPCR: Validate primer efficiency, specificity (melt curve analysis), and dynamic range. Use multiple reference genes for normalization.

    • For Western blotting: Validate antibody specificity using positive and negative controls (e.g., overexpression and knockdown samples).

    • For flow cytometry: Include appropriate isotype controls and perform titration experiments to determine optimal antibody concentrations.

  • Biological validation:

    • Use multiple detection methods (e.g., RT-qPCR and Western blotting) to confirm expression patterns.

    • Include positive control tissues/cells known to express Laptm4b.

    • Confirm knockdown or overexpression effectiveness when manipulating Laptm4b levels.

  • Documentation and reporting standards:

    • Clearly describe all experimental conditions, including cell isolation methods, activation protocols, and timepoints.

    • Report detailed methods including primer sequences, antibody sources and dilutions, and data normalization procedures.

    • Present raw data alongside normalized results when possible.

By systematically addressing these potential sources of variability, researchers can improve consistency and reliability in Laptm4b expression studies.

What are common pitfalls in functional assays for rat Laptm4b and how can they be avoided?

Functional studies of rat Laptm4b present several challenges that researchers should anticipate and address:

  • Overexpression artifacts:

    • Pitfall: Non-physiological expression levels may cause mislocalization or non-specific effects.

    • Solution: Use inducible expression systems to titrate protein levels, include appropriate controls (empty vector, unrelated protein), and validate findings using knockdown approaches.

  • Isoform confusion:

    • Pitfall: Different Laptm4b isoforms may have distinct functions but be studied interchangeably.

    • Solution: Clearly specify which isoform(s) are being studied. As seen in human studies, LAPTM4B constructs may encode multiple isoforms simultaneously (e.g., LAPTM4B iso24/20) . Design constructs that express individual isoforms when possible.

  • Improper localization assessment:

    • Pitfall: As a multi-pass transmembrane protein, Laptm4b function depends on proper subcellular localization.

    • Solution: Confirm localization using subcellular fractionation and/or confocal microscopy with appropriate markers for different compartments (endosomes, lysosomes, Golgi, plasma membrane).

  • Partner protein variability:

    • Pitfall: Laptm4b functions through interactions with partners like GARP , which may be expressed at variable levels across cell types.

    • Solution: Quantify expression of known interaction partners in the experimental system and consider co-expression approaches when necessary.

  • Assay-specific considerations:

    • For TGF-β1 production studies: Distinguish between effects on proTGF-β1 cleavage, latent TGF-β1 secretion, and TGF-β1 activation using approaches similar to those in human studies (Western blotting, ELISA, reporter assays) .

    • For receptor trafficking studies: Use surface biotinylation or antibody feeding approaches to track internalization and recycling kinetics.

    • For interaction studies: Include appropriate controls (non-interacting proteins) and validate interactions using multiple complementary techniques.

By anticipating these pitfalls and implementing appropriate controls and validation strategies, researchers can increase confidence in functional assay results for rat Laptm4b.

How can researchers validate Laptm4b knockdown or overexpression models?

  • mRNA level validation:

    • RT-qPCR using primers targeting regions common to all variants and, when possible, variant-specific primers similar to those used for human LAPTM4B Va and Vb .

    • Include appropriate housekeeping genes for normalization.

    • For knockdown approaches, quantify the degree of reduction for each variant.

    • For overexpression, confirm expression of the correct transcript variant(s).

  • Protein level validation:

    • Western blotting to confirm reduced or increased protein levels, with attention to detecting all relevant isoforms.

    • Flow cytometry or immunofluorescence to assess changes at the single-cell level and evaluate potential heterogeneity in manipulation effectiveness.

    • For tagged constructs, confirm tag detection correlates with specific Laptm4b antibody detection.

  • Functional validation:

    • Confirm expected changes in known Laptm4b functions, such as TGF-β1 production in Tregs .

    • For knockdown, rescue experiments (reintroduction of knockdown-resistant Laptm4b) can confirm specificity.

    • For overexpression, include non-functional mutants as controls.

  • Specificity controls:

    • Assess expression of related family members (Laptm4a, Laptm5) to confirm specificity of manipulation.

    • Evaluate expression of known interaction partners (e.g., GARP) to detect potential compensatory changes.

    • For CRISPR approaches, sequence the targeted locus to confirm expected edits and check for off-target effects.

  • Stable phenotype confirmation:

    • For stable cell lines, confirm maintained knockdown or overexpression over passage.

    • For inducible systems, demonstrate dose-dependent and reversible effects.

How should researchers interpret conflicting data between in vitro and in vivo studies of Laptm4b function?

Discrepancies between in vitro and in vivo findings are common in protein function studies and require careful interpretation. For Laptm4b research, consider the following systematic approach:

  • Context-dependent functions: Laptm4b may have different roles depending on cellular context. In human studies, LAPTM4B has distinct functions in immune cells versus tumor cells . Consider whether observed differences reflect true biological context-dependence rather than experimental artifacts.

  • Physiological expression levels: In vitro overexpression may not accurately represent in vivo function. Compare expression levels between your experimental systems and physiological conditions. For example, human LAPTM4B variants show differential expression patterns in different T cell populations .

  • Interaction partner availability: Laptm4b functions through interactions with proteins like GARP . Differences in expression of these partners between in vitro and in vivo settings may explain functional discrepancies.

  • Model system limitations:

    • Cell lines may lack regulatory mechanisms present in primary cells

    • Isolated cell populations lack tissue architecture and intercellular communication

    • Animal models may have species-specific differences in Laptm4b regulation or function

  • Reconciliation strategies:

    • Use primary cells in vitro to bridge the gap between cell lines and in vivo models

    • Employ tissue-specific conditional manipulation in vivo to isolate cell-autonomous effects

    • Develop ex vivo systems (e.g., organoids) that better recapitulate tissue complexity

    • Use rescue experiments with specific Laptm4b variants or mutants to identify critical functional domains

When reporting conflicting results, clearly describe the experimental conditions of each system, discuss potential explanations for observed differences, and present corroborating evidence from complementary approaches when possible.

What are promising therapeutic applications targeting Laptm4b in immune disorders and cancer?

Given Laptm4b's dual roles in immune regulation and oncogenesis, several therapeutic applications warrant investigation:

  • Immunotherapy enhancement: Since LAPTM4B inhibits TGF-β1 production in Tregs , modulating its function could potentially enhance anti-tumor immune responses. Targeting Laptm4b to increase TGF-β1 suppression by Tregs might be beneficial in autoimmune conditions, while inhibiting Laptm4b function to enhance TGF-β1 production might improve tolerance in transplantation settings.

  • Cancer therapy approaches: In various human cancers, high LAPTM4B levels correlate with poor prognosis , suggesting it as a potential therapeutic target. Strategies could include:

    • Small molecule inhibitors disrupting Laptm4b interactions with key partners

    • Peptide-based approaches targeting specific functional domains

    • Antibody-drug conjugates exploiting Laptm4b surface expression on cancer cells

    • siRNA or antisense oligonucleotides to reduce Laptm4b expression

  • Combination therapy potential: Targeting Laptm4b alongside existing therapies could enhance efficacy. For example, inhibiting Laptm4b in conjunction with EGFR-targeted therapies might prevent resistance mechanisms related to receptor trafficking that Laptm4b modulates .

  • Biomarker applications: Before direct targeting, Laptm4b expression patterns could serve as biomarkers for predicting disease progression or treatment response, similar to findings in human cancers where LAPTM4B levels correlate with prognosis .

Research groups pursuing these therapeutic directions should focus on developing specific tools for targeting rat Laptm4b, validating their effects on immune function and tumor growth in relevant models, and assessing potential off-target effects given Laptm4b's expression across multiple tissues.

What advanced technologies are emerging for studying Laptm4b regulation and function?

Several cutting-edge technologies offer new opportunities for understanding Laptm4b biology:

  • CRISPR-based screening approaches:

    • CRISPR activation/inhibition (CRISPRa/CRISPRi) libraries targeting potential regulators of Laptm4b expression

    • CRISPR tiling screens to identify functional domains within Laptm4b

    • Base editing to introduce specific mutations without disrupting the entire gene

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize Laptm4b localization and trafficking with nanometer precision

    • Live-cell imaging with split fluorescent proteins to monitor Laptm4b interactions in real-time

    • Correlative light and electron microscopy to precisely define Laptm4b's subcellular localization

  • Proteomics approaches:

    • Proximity labeling methods (BioID, APEX) to identify the Laptm4b interactome in different cellular compartments

    • Quantitative interaction proteomics to compare binding partners across different conditions

    • Phosphoproteomics to identify signaling pathways affected by Laptm4b manipulation

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell populations with distinctive Laptm4b expression patterns

    • Single-cell proteomics to correlate Laptm4b levels with protein networks

    • Spatial transcriptomics to map Laptm4b expression within tissue architecture

  • Structural biology techniques:

    • Cryo-electron microscopy to determine Laptm4b structure, particularly in complex with interacting partners

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • In silico structural prediction using AlphaFold2 or similar tools to guide functional studies

These technologies, while challenging to implement, offer unprecedented opportunities to understand Laptm4b biology at molecular, cellular, and tissue levels with implications for both basic science and therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.