Recombinant Rat Magnesium transporter MRS2 homolog, mitochondrial (Mrs2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To ensure a specific tag, please inform us during your order, and we will prioritize its inclusion.
Synonyms
Mrs2; Mrs2l; Rpt; Magnesium transporter MRS2 homolog, mitochondrial; MRS2-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-434
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Mrs2
Target Protein Sequence
SLAACCGRATPLTSGSQKAPSTPRTAGDVYRFRTSDASQATLASVAQVFAVTKFDKEGNV TSFERKKTELYHELALQARDLRFQHVMSITTRNNRIIMRMEYLKAVITPEYLLILDYRNL NLEHWLFRELPSQLAGEGQLVTYPLPFEFRAIEALLQYWINTLQGKLSILQPLILETLDA LVDPKHSSVDRSKLHVLLQNGKSLSELETDIKIFKESILELLDEEEMLEELCLTKWSDPH VFEQSSTGIDHAEEMELLLENYYRLADDLSNEARELRVLIDDSQSIIFINLDSHRNVMMR LNLQLTMGTFSLSLFGLMGVAFGMNLESSLEEDHRVFWLITGIMFMGSGLIWRRLLSFLG RQLEAPLPPVMASLPKKTLLADRRMDVKNSLRPEGLGAGRTILASR
Uniprot No.

Target Background

Function
A mitochondrial magnesium transporter mediating magnesium influx into the mitochondrial matrix. It is essential for the normal expression of mitochondrial respiratory complex I subunits.
Gene References Into Functions
  1. Transgenic rat studies demonstrated that Mrs2 is predominantly expressed in neurons, not oligodendrocytes, and is localized to the mitochondrial inner membrane (PMID: 21253565).
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the MRS2 protein?

MRS2 (Mitochondrial RNA Splicing 2) is a magnesium ion (Mg²⁺) channel protein located in the inner mitochondrial membrane that facilitates Mg²⁺ influx into the mitochondrial matrix. The protein belongs to the CorA/Mrs2/Alr1 superfamily of Mg²⁺ transporters, characterized by the highly conserved Gly-Met-Asn (GMN) motif at the end of the first transmembrane helix, which is essential for proper Mg²⁺ transport function . Human MRS2 contains a large amino terminal domain (NTD) oriented within the mitochondrial matrix (comprising approximately 71% of the mature polypeptide chain), two transmembrane domains (TM1 and TM2), an intermembrane space loop, and a smaller carboxyl terminal domain also oriented within the matrix .

Recent structural studies have revealed that MRS2 forms a pentameric assembly that creates a channel for Mg²⁺ permeation . Each monomer contributes to the formation of a central pore through which Mg²⁺ ions pass. The channel contains specific structural features including an R-ring composed of five Arg332 residues that functions as a charge repulsion barrier, potentially playing a key role in the gating mechanism for Mg²⁺ permeation .

How does MRS2 expression differ across cell types in the central nervous system?

Studies using MRS2-GFP recombinant BAC transgenic rats have demonstrated that MRS2 is predominantly expressed in neurons rather than oligodendrocytes in the central nervous system (CNS) . This expression pattern is particularly significant because it suggests that the maintenance of myelin by oligodendrocytes is indirectly dependent on neuronal MRS2 function. Ultrastructural analysis has localized the MRS2 protein specifically to the inner membrane of mitochondria .

This differential expression pattern helps explain the phenotype observed in dmy/dmy rats with MRS2 mutations, where severe myelin breakdown occurs in the CNS after normal postnatal completion of myelination . These findings indicate that while neurons predominantly express MRS2, proper mitochondrial function supported by MRS2-mediated Mg²⁺ homeostasis is essential for the maintenance of myelin by oligodendrocytes. This represents an important example of cell-type interdependence in the CNS, where neuronal mitochondrial function impacts oligodendrocyte health and myelin maintenance.

What methods are used to generate and validate recombinant rat MRS2 for research purposes?

Generating recombinant rat MRS2 typically involves several molecular biology and protein expression techniques:

  • Gene Cloning and Vector Construction: The rat Mrs2 gene is amplified from rat cDNA using PCR with specific primers, then cloned into an appropriate expression vector. For fluorescent tagging, GFP fusion constructs can be created .

  • BAC Transgenic Approach: For in vivo studies, bacterial artificial chromosome (BAC) transgenic techniques can be employed to generate MRS2-GFP recombinant rats, allowing visualization of the protein's expression patterns across different tissues and cell types .

  • Heterologous Expression Systems: For protein production, several expression systems may be used:

    • Mammalian cell lines for proper post-translational modifications

    • Yeast systems (e.g., P. pastoris) for higher yields of eukaryotic membrane proteins, as demonstrated in structural studies of human MRS2

    • Bacterial systems for higher yield but potentially different protein folding

  • Purification Strategies: For structural and biochemical studies, the recombinant protein typically undergoes:

    • Detergent solubilization of membrane fractions

    • Affinity chromatography using tags (His, FLAG, etc.)

    • Size exclusion chromatography for further purification and assessment of oligomeric state

  • Validation Methods:

    • Western blotting to confirm protein expression and size

    • Immunofluorescence for subcellular localization

    • Functional assays measuring mitochondrial Mg²⁺ uptake

    • Structural verification through techniques like cryo-EM

To improve expression and stability for structural studies, researchers have employed strategies such as creating truncated constructs (e.g., amino acids 62-431 of human MRS2) and using fusion proteins like thermostabilized BRIL to enhance expression properties .

How does the rat MRS2 compare structurally to human MRS2 and bacterial CorA?

The structural relationship between rat MRS2, human MRS2, and bacterial CorA reveals both conservation and divergence across evolution:

These structural differences likely reflect evolutionary adaptations to the specific cellular environments and functional requirements of mitochondrial versus bacterial magnesium transport systems.

What are the molecular mechanisms underlying MRS2 regulation by magnesium?

The regulation of MRS2 by magnesium involves sophisticated molecular mechanisms that operate at multiple structural levels to control channel activity:

  • NTD-Mediated Autoregulation: The amino terminal domain (NTD) of human MRS2 serves as a regulatory domain that responds to Mg²⁺ concentrations. Unlike the bacterial CorA channels, the human MRS2 NTD self-associates into a homodimer rather than maintaining the pentameric assembly . Mg²⁺ binding to the NTD disrupts these homomeric interactions, leading to inhibition of mitochondrial Mg²⁺ uptake through a negative feedback mechanism . This represents a distinct autoregulatory mechanism that has evolved in the eukaryotic MRS2 channel.

  • Mg²⁺ Binding Sites: Structural studies have identified multiple Mg²⁺ binding sites in MRS2, including a unique interfacial binding site (site 3) located at the inter-subunit interface. This site is formed by acidic residues including E138, E243, and D247 from one subunit and E312 from an adjacent subunit . This interfacial binding site differs significantly from those in bacterial CorA channels, suggesting a distinct channel regulation mechanism for MRS2.

  • Conformational Changes: Mg²⁺ binding to the NTD induces significant conformational changes in the secondary, tertiary, and quaternary structure of the protein . These changes are likely part of the mechanism that couples Mg²⁺ sensing to channel gating.

  • Structural Basis for Ion Selectivity: The electropositive R332 ring, formed by five arginine residues, creates a narrow constriction in the pore that presents an energy barrier to cation permeation . This structural feature contributes to the ion selectivity of the channel, as demonstrated by experiments showing that substitution of R332 with serine (R332S) significantly enhances Mg²⁺ currents .

  • Role of Chloride Ions: Recent molecular dynamics simulations suggest that chloride ions (Cl⁻) may play a role in MRS2 function, with a Cl⁻-bound R-ring potentially functioning as a charge repulsion barrier . The chloride ion may act as a "ferry" to jointly gate Mg²⁺ permeation in human MRS2 .

These complex regulatory mechanisms enable MRS2 to maintain mitochondrial Mg²⁺ homeostasis by adjusting channel activity in response to changing Mg²⁺ concentrations, ensuring proper mitochondrial function while preventing excessive Mg²⁺ accumulation.

How do mutations in MRS2 affect its function and what are the implications for mitochondrial physiology?

Mutations in MRS2 can profoundly impact its function with cascading effects on mitochondrial physiology and cellular health:

  • GMN Motif Mutations: The highly conserved Gly-Met-Asn (GMN) motif at the end of the first transmembrane helix is essential for proper channel function. Mutations in this motif either completely abolish Mg²⁺ transport or significantly alter the ion selectivity of the channel . These mutations directly affect the core transport mechanism of the channel.

  • The Rat dmy Mutation: The rat demyelination (dmy) mutation represents a particularly informative case study. A G-to-A transition located 177 bp downstream of exon 3 in the Mrs2 gene creates a novel splice acceptor site, resulting in functional inactivation of the mutant allele . This mutation leads to severe myelin breakdown in the central nervous system after normal postnatal completion of myelination, indicating that MRS2 function is essential for myelin maintenance rather than initial production .

  • Mitochondrial Consequences: In dmy/dmy rats with MRS2 mutation, severe mitochondrial deficits are observed:

    • Markedly elevated lactic acid concentration in cerebrospinal fluid

    • 60% reduction in ATP levels

    • Increased numbers of mitochondria in the swollen cytoplasm of oligodendrocytes

    These findings clearly demonstrate that disruption of mitochondrial Mg²⁺ homeostasis due to MRS2 dysfunction has catastrophic effects on energy metabolism.

  • R332 Mutations: Substitution of the R332 residue with serine (R332S) creates a gain-of-function channel with enhanced conductance for Mg²⁺, Ca²⁺, K⁺, and Na⁺ . This mutation effectively reduces the energy barrier for ion permeation through the channel, demonstrating the critical role of this residue in controlling ion flux.

  • NTD Mg²⁺-Binding Site Mutations: Mutations of specific residues mediating Mg²⁺ binding to the NTD not only decrease Mg²⁺-binding affinity approximately sevenfold but also prevent Mg²⁺ binding-induced structural changes . Intriguingly, disruption of NTD Mg²⁺ binding potentiates mitochondrial Mg²⁺ uptake in both wild-type and Mrs2 knockout cells, revealing the autoregulatory role of the NTD .

These findings collectively demonstrate that MRS2 mutations can disrupt mitochondrial Mg²⁺ homeostasis, impair energy production, and ultimately lead to cellular dysfunction with potential implications for neurological disorders, particularly those involving myelin maintenance.

What experimental approaches can be used to measure MRS2-mediated magnesium transport?

Several sophisticated experimental techniques can be employed to measure and characterize MRS2-mediated magnesium transport:

Each of these experimental approaches provides complementary information about different aspects of MRS2 function, from structural changes and ion binding to transport kinetics and physiological consequences. Combining multiple techniques offers the most comprehensive understanding of this important mitochondrial magnesium channel.

How does MRS2 function differ between experimental models and what factors influence its activity?

MRS2 function exhibits notable variations across experimental models, influenced by several factors that researchers should consider when designing studies and interpreting results:

  • Species-Specific Differences:

    • Structural Variations: While rat and human MRS2 share significant homology, important structural differences exist between mammalian MRS2 and its orthologs in yeast (Mrs2) and bacteria (CorA). Human MRS2 shares only 55.4% sequence similarity with yeast Mrs2 (20.1% through the NTD) and 43.3% with bacterial CorA (17.0% through the NTD) . These differences manifest in distinct regulatory mechanisms.

    • Functional Consequences: While all family members transport Mg²⁺, the regulatory mechanisms differ. For instance, human MRS2 NTD forms a homodimer unlike the pentameric bacterial CorA , suggesting divergent evolution of regulatory mechanisms.

  • Expression System Effects:

    • Protein Modifications: The expression system chosen (mammalian cells, yeast, bacteria) affects post-translational modifications and protein folding.

    • Membrane Environment: The lipid composition of different expression systems may influence channel function by affecting membrane properties.

    • Expression Levels: Studies report that truncated constructs (MRS2 EM) consistently produce larger Mg²⁺ currents than full-length MRS2 (MRS2 FL), likely due to higher surface expression .

  • Experimental Conditions:

    • Ionic Environment: The presence of different ions significantly affects MRS2 function. For example, Mg²⁺ currents were not observed in wild-type MRS2 in recording solutions with >100 mM Cl⁻ , suggesting complex ion interactions.

    • Divalent Cation Specificity: Mg²⁺ and Ca²⁺ suppress oligomerization of the MRS2 NTD, while Co²⁺ has no effect on the NTD but disassembles full-length MRS2 , indicating distinct effects of different divalent cations.

    • Membrane Potential: Evidence suggests that membrane potential likely serves as the driving force for Mg²⁺ permeation through MRS2 .

  • Structural Modifications:

    • Truncation Effects: For structural studies, researchers have constructed truncated channels (e.g., amino acids 62-431) with thermostabilized BRIL protein fusions to enhance expression and stability . These modifications can alter function.

    • Mutations: The R332S mutation drastically enhances conductance for multiple cations, including Mg²⁺, Ca²⁺, K⁺, and Na⁺ , demonstrating how single amino acid changes can profoundly alter channel properties.

  • Physiological Context:

    • Cell Type Specificity: In rats, MRS2 is predominantly expressed in neurons rather than oligodendrocytes , suggesting cell type-specific functions and regulation.

    • Developmental Stage: The rat dmy mutation demonstrates that MRS2 function is critical for myelin maintenance rather than initial formation , highlighting the importance of developmental timing in studying MRS2 function.

Understanding these variables is crucial for designing experiments, interpreting results across different model systems, and translating findings from basic research to potential clinical applications. Researchers should carefully consider which experimental model best addresses their specific research questions about MRS2 function.

How does MRS2 dysfunction contribute to pathological conditions and what therapeutic strategies might target this channel?

MRS2 dysfunction has been implicated in several pathological conditions, with emerging evidence suggesting potential therapeutic strategies:

  • Demyelinating Disorders:

    • Pathological Mechanism: The rat demyelination (dmy) mutation in Mrs2 causes severe myelin breakdown in the central nervous system after normal postnatal completion of myelination . This establishes that Mg²⁺ homeostasis in CNS mitochondria is essential for myelin maintenance.

    • Therapeutic Implications: Strategies to restore mitochondrial Mg²⁺ homeostasis could potentially preserve myelin integrity in demyelinating disorders. This might include targeted delivery of Mg²⁺ to mitochondria or enhancing MRS2 expression/function in neurons that support oligodendrocytes.

  • Mitochondrial Dysfunction and Energy Deficiency:

    • Pathological Features: MRS2 dysfunction leads to significant mitochondrial deficits, including markedly elevated lactic acid in cerebrospinal fluid, 60% reduction in ATP levels, and aberrant mitochondrial morphology . These energetic impairments likely contribute to cellular dysfunction.

    • Therapeutic Approaches: Compounds that bypass mitochondrial energy production or enhance it through alternative pathways could mitigate the consequences of MRS2 dysfunction. Mitochondrial-targeted antioxidants might also protect against secondary oxidative damage.

  • Ion Homeostasis Disruption:

    • Pathological Significance: MRS2 can potentially conduct both Mg²⁺ and Ca²⁺ , suggesting that dysfunction might disrupt both magnesium and calcium homeostasis, affecting numerous cellular processes.

    • Therapeutic Strategies: Modulators of other ion channels or transporters might be developed to compensate for MRS2 dysfunction, restoring ionic balance.

  • Potential Therapeutic Targets:

    • R-ring Modulation: The R332 residue forms a critical constriction in the channel pore that controls ion flux . Compounds designed to interact with this region could potentially modulate channel activity.

    • NTD-Targeting Approaches: The NTD serves as a regulatory domain that responds to Mg²⁺ concentrations . Molecules that mimic or interfere with this autoregulatory mechanism could enhance or suppress channel activity as needed.

    • Gain-of-Function Mutations: The R332S mutation enhances channel conductance , suggesting that similar structural modifications could be therapeutic targets for conditions requiring increased mitochondrial Mg²⁺ uptake.

    • Chloride-Dependent Regulation: The interaction between chloride ions and the R-ring may be exploitable for therapeutic purposes, potentially allowing modulation of Mg²⁺ permeation .

  • Experimental Therapeutic Strategies:

    • Gene Therapy: For inherited MRS2 mutations, gene replacement therapies could restore normal channel function. Transgenic rescue with wild-type Mrs2-cDNA has validated this approach in experimental models .

    • Small Molecule Modulators: Compounds that bind to specific regulatory sites on MRS2 could be developed to enhance or inhibit channel activity depending on the pathological context.

    • Mitochondrial-Targeted Mg²⁺ Delivery: Novel delivery systems that bypass MRS2 to restore mitochondrial Mg²⁺ levels could potentially address the downstream consequences of channel dysfunction.

The development of these therapeutic strategies requires further research into the structure-function relationships of MRS2, the specific pathological mechanisms in different disease contexts, and the development of assays to screen for compounds that modulate channel activity. Given the fundamental role of mitochondrial Mg²⁺ in cellular bioenergetics, targeting MRS2 represents a promising approach for diseases involving mitochondrial dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.