Recombinant Rat Magnesium transporter protein 1 (Magt1)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Magnesium transporter protein 1 (Magt1) is a mammalian Mg2+-selective transporter essential for cellular magnesium uptake and vertebrate embryonic development . In rats, this protein is encoded by the Magt1 gene, also known by its synonym Iag2 . Rat Magt1 (UniProt accession: O35777) functions as a membrane-bound protein that facilitates the transport of magnesium ions across cell membranes, playing a vital role in maintaining proper cellular magnesium levels necessary for numerous enzymatic reactions and physiological processes .

The rat Magt1 protein is characterized by five putative transmembrane regions with specific structural elements including a cleavage site, N-glycosylation sites, and multiple phosphorylation sites that collectively enable its function as an ion transporter . These structural features are highly conserved across species, reflecting the fundamental importance of magnesium transport in cellular physiology across vertebrates.

Nomenclature and Classification

Rat Magt1 is officially known as Magnesium transporter protein 1, with the short name MagT1 . It is also referred to as Implantation-associated protein (IAP), reflecting its initially discovered role in reproductive processes . In humans, MAGT1 has been classified as part of the solute carrier family and is sometimes designated as SLC58A1 . While this classification hasn't been explicitly extended to rat Magt1 in the available literature, the high degree of homology suggests a similar functional categorization would be appropriate.

PropertyDetails for Rat Magt1
Full NameMagnesium transporter protein 1
Short NameMagT1
Alternative NameImplantation-associated protein (IAP)
Gene SymbolMagt1
Gene SynonymIag2
UniProt AccessionO35777
Expression Region30-335
Protein SizeApproximately 45-50 kDa (glycosylated)

Magnesium Transport Mechanisms

The primary function of rat Magt1 is to serve as a selective transporter for magnesium ions across cellular membranes . Magnesium is an essential mineral cofactor for hundreds of enzymatic reactions and plays crucial roles in DNA replication, protein synthesis, energy metabolism, and neuromuscular function. Magt1 facilitates the controlled uptake of magnesium into cells, helping maintain the precise intracellular magnesium concentrations necessary for these vital processes.

The mechanism of magnesium transport by Magt1 involves its transmembrane domains creating a selective channel or pore through which magnesium ions can pass. The specificity for magnesium over other divalent cations highlights the specialized nature of this transporter in cellular magnesium homeostasis. This selectivity is particularly important given the different roles and concentrations of various metal ions within cells.

Role in N-Glycosylation Processes

Beyond magnesium transport, Magt1 functions as an accessory component of the N-oligosaccharyl transferase (OST) complex, specifically the STT3B-containing form . This complex catalyzes the transfer of high mannose oligosaccharides from lipid-linked oligosaccharide donors to asparagine residues within specific consensus motifs (Asn-X-Ser/Thr) in nascent polypeptide chains .

In this capacity, Magt1 is involved in N-glycosylation of STT3B-dependent substrates and is specifically required for the glycosylation of acceptor sites near cysteine residues . The protein may function in its oxidized form to create transient mixed disulfides with glycoprotein substrates, facilitating access of STT3B to unmodified acceptor sites . This function highlights Magt1's multifaceted role beyond simple magnesium transport and underscores its importance in protein processing and maturation.

Involvement in Immune Function

Studies on Magt1, particularly in humans, have revealed its importance in immune system function. Magt1 deficiency causes selective defects in N-linked glycosylation and expression of immune-response genes . While most of this research has been conducted on human MAGT1, the high degree of conservation between species suggests similar immune-related functions for rat Magt1.

Research has shown that MAGT1 deficiency is associated with immunodeficiency conditions, where restored MAGT1 expression in natural killer (NK) and CD8+ T cells can restore expression of important immune receptors like NKG2D . This restoration improves immune cell function, highlighting the importance of MAGT1 in maintaining proper immune responses. Similar mechanisms likely exist for rat Magt1, making it an important protein for immune function in rats as well.

Expression Systems and Methods

Recombinant rat Magt1 can be produced using various expression systems, though the specific methods for rat Magt1 aren't detailed in the search results. Based on similar recombinant proteins, expression systems like Escherichia coli are commonly employed for production . For membrane proteins like Magt1, eukaryotic expression systems may provide advantages for proper folding and post-translational modifications.

The production process typically involves cloning the rat Magt1 gene sequence into an appropriate expression vector, transforming host cells with this construct, and inducing protein expression under optimized conditions. For membrane proteins, special considerations regarding solubilization and proper membrane insertion are necessary to maintain functional integrity.

Purification and Quality Control

After expression, recombinant rat Magt1 requires purification to isolate it from other cellular components. Common purification approaches include affinity chromatography, which can be facilitated by adding tags such as His-tags to the recombinant protein . These tags enable selective binding to specific resins, allowing efficient separation of the target protein.

Quality control for recombinant rat Magt1 typically involves assessing purity through methods like SDS-PAGE, where the glycosylated protein appears at approximately 45-50 kDa . Additional characterization may include mass spectrometry for precise molecular weight determination and activity assays to confirm functional integrity. The purified product is often characterized as having greater than 90% purity for research applications .

Research Applications

Recombinant rat Magt1 serves as a valuable tool for various research applications investigating magnesium transport, protein glycosylation, and related cellular processes. The purified protein can function as a standard in assays measuring endogenous Magt1 expression or as an antigen for antibody production. These antibodies enable techniques such as Western blotting, immunohistochemistry, and flow cytometry for detecting and quantifying Magt1 in biological samples .

In functional studies, recombinant Magt1 facilitates investigation of magnesium transport mechanisms, protein-protein interactions within the OST complex, and the role of Magt1 in N-glycosylation processes. Such studies contribute to our understanding of fundamental cellular processes and may reveal new insights into magnesium homeostasis in both physiological and pathological conditions.

Therapeutic Potential

The therapeutic potential of recombinant Magt1 or Magt1-targeted therapies represents an emerging area of interest. Given the importance of magnesium in numerous cellular processes and the association of Magt1 deficiency with certain disorders, therapeutic approaches targeting Magt1 function may hold promise for treating conditions related to magnesium dysregulation or defective N-glycosylation.

Research on human MAGT1 has demonstrated that genetic correction of MAGT1 deficiency can restore immune cell function . Similar approaches might be applicable in animal models or potentially in human conditions where MAGT1 dysfunction contributes to disease pathology. Recombinant rat Magt1 serves as an important research tool in preclinical studies evaluating such therapeutic strategies.

Diagnostic Applications

Recombinant rat Magt1 has potential applications in diagnostic assays. It can serve as a standard or control in ELISA-based techniques designed to measure Magt1 levels in biological samples . Such assays are valuable in research contexts studying conditions associated with altered magnesium homeostasis or Magt1 expression.

Additionally, antibodies developed against recombinant rat Magt1 enable detection of the protein in tissue samples through techniques like immunohistochemistry . These antibodies, with specificity for rat Magt1, can detect the protein in various tissues including brain, liver, and cell lines like NIH/3T3 and HuH-7 , providing tools for studying Magt1 expression patterns in different physiological and pathological contexts.

Functional Conservation

The functional roles of Magt1 appear well conserved between rat and human. Both serve as selective magnesium transporters essential for cellular magnesium uptake . Similarly, both rat and human Magt1 are involved in N-glycosylation processes as components of the OST complex , specifically in glycosylation of acceptor sites near cysteine residues.

The involvement of Magt1 in immune function has been particularly well-studied in humans, where MAGT1 deficiency leads to immunodeficiency conditions characterized by increased susceptibility to Epstein-Barr virus infection . While less information is available specifically about rat Magt1's role in immunity, the high degree of functional conservation suggests similar immune-related functions in rats.

This functional conservation underscores the value of rat models in studying Magt1-related processes and pathologies, potentially providing insights applicable to human health and disease. The similarities between rat and human Magt1 make recombinant rat Magt1 a valuable tool for preliminary research that may later translate to human applications.

Recent Advances in Magt1 Research

Recent research has expanded our understanding of Magt1 beyond simple magnesium transport. Studies have illuminated its importance in N-glycosylation processes, particularly for specific substrates with glycosylation sites near cysteine residues . Additionally, research has highlighted the significance of Magt1 in immune function, where deficiency can lead to immunological disorders characterized by impaired T-cell activation and NK cell function .

Advancements in genetic editing technologies, such as CRISPR/Cas9, have enabled more precise studies of Magt1 function through targeted gene modifications . These approaches have demonstrated that restoration of Magt1 expression can correct functional deficits in cells lacking this protein, opening possibilities for therapeutic applications. CRISPR-targeted MAGT1 insertion has been shown to restore NKG2D expression and function in human NK and CD8+ T cells, offering potential treatment options for conditions associated with MAGT1 deficiency .

Emerging Applications and Potential

Future research on recombinant rat Magt1 may focus on several promising directions. One area is developing more efficient production methods for obtaining higher yields of functional protein, which would facilitate larger-scale studies and applications. Additionally, structure-function studies may provide deeper insights into the mechanisms of magnesium transport and the protein's role in N-glycosylation.

Therapeutic applications represent another important frontier. The development of Magt1-targeted therapies for conditions associated with magnesium dysregulation or defective N-glycosylation could emerge from continued research. Similarly, diagnostic applications leveraging recombinant Magt1 or anti-Magt1 antibodies might find utility in both research and clinical settings, particularly for studying conditions where magnesium homeostasis is disrupted.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your product.
Synonyms
Magt1; Iag2; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1; Implantation-associated protein; IAP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-335
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Magt1
Target Protein Sequence
QRKKEKVLVEKVIQLMEWTNQRPVIRMNGDKFRPLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANFWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPK RADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAAASDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS
Uniprot No.

Target Background

Function
Magnesium transporter protein 1 (Magt1) functions as an accessory component of the N-oligosaccharyl transferase (OST) complex. This complex catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Magt1 is involved in N-glycosylation of STT3B-dependent substrates. It is specifically required for the glycosylation of a subset of acceptor sites located near cysteine residues. In this role, Magt1 appears to act redundantly with TUSC3. In its oxidized form, Magt1 is thought to form transient mixed disulfides with a glycoprotein substrate, facilitating access for STT3B to the unmodified acceptor site. Magt1 also exhibits oxidoreductase-independent functions within the STT3B-containing OST complex, potentially involving substrate recognition. Additionally, Magt1 may play a role in Mg(2+) transport in epithelial cells.
Gene References Into Functions
  1. Research indicates that Mg and MagT1 play a significant role in the osteogenic differentiation of rat bone marrow stromal cells (rBMSCs) and may contribute to bone regeneration. PMID: 26358767
Database Links
Protein Families
OST3/OST6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Magnesium Transporter 1 (MAGT1) and what are its main functions in rat cells?

MAGT1 is a selective magnesium transporter protein that plays a crucial role in maintaining intracellular magnesium homeostasis in various cell types. In rat cells, MAGT1 is involved in regulating magnesium influx across the cell membrane, which is essential for numerous cellular processes . This protein is particularly important in osteogenic differentiation of rat bone marrow stem cells (rBMSCs), where it helps maintain the proper magnesium concentration required for cell differentiation and bone formation processes . MAGT1 expression increases during osteogenic differentiation, suggesting its importance in the transition from undifferentiated to differentiated states in these cells . Beyond its role as a magnesium transporter, MAGT1 may also be involved in N-glycosylation processes, though this function has been more extensively studied in human cells than in rat models .

How does the structure of rat MAGT1 compare to human MAGT1?

Rat MAGT1 shares significant structural homology with human MAGT1, though with some species-specific variations. The protein contains transmembrane domains characteristic of ion transporters and conserved regions essential for magnesium binding and transport . Based on sequence data, rat MAGT1 contains key functional domains including magnesium transport regions and potential glycosylation sites . The amino acid sequence (AA 1-131) of mouse MAGT1, which is closely related to rat MAGT1, contains a transmembrane region and magnesium-binding motifs that are likely conserved in the rat ortholog . The full sequence contains regions important for membrane localization and ion selectivity, though complete structural characterization through crystallography studies remains limited in the literature.

What is the tissue distribution and subcellular localization of MAGT1 in rats?

MAGT1 is ubiquitously expressed across rat tissues, with notable expression in bone marrow stem cells, osteoblasts, and other cell types involved in bone formation and remodeling . At the subcellular level, MAGT1 primarily localizes to the plasma membrane, consistent with its function as a transmembrane magnesium transporter . In rat bone marrow stem cells, MAGT1 expression patterns change during differentiation, with increased expression observed during osteogenic differentiation . This suggests cell-type and developmental-stage specific regulation of MAGT1 expression. The protein may also associate with components of the endoplasmic reticulum in some cell types, particularly in relation to its potential role in N-glycosylation processes, though this aspect requires further investigation in rat models.

How does MAGT1 regulate osteogenic differentiation in rat bone marrow stem cells?

MAGT1 plays a critical role in the osteogenic differentiation of rat bone marrow stem cells (rBMSCs) through multiple mechanisms. Research has demonstrated that MAGT1 expression increases significantly during osteogenic differentiation, indicating its importance in this process . The protein facilitates magnesium transport, which is essential for the activation of various signaling pathways and transcription factors involved in osteogenesis. When MAGT1 is knocked down using siRNA techniques, researchers observed reduced expression of key osteogenic markers including alkaline phosphatase (ALP), osteocalcin (OCN), collagen-1 (COL-1), and runt-related transcription factor 2 (RUNX2) . Additionally, matrix mineralization was significantly reduced in MAGT1-knockdown cells, further confirming its crucial role in bone formation processes . The relationship between MAGT1 and osteogenic differentiation appears to be mediated through intracellular magnesium homeostasis, as low extracellular magnesium conditions also resulted in reduced osteogenic marker expression similar to MAGT1 knockdown effects .

What experimental approaches are most effective for studying MAGT1 function in rat models?

Several complementary experimental approaches have proven effective for studying MAGT1 function in rat models. Gene knockdown using siRNA or shRNA targeting MAGT1 has been successfully employed to assess its functional role in processes such as osteogenic differentiation . Cell culture models, particularly primary rat bone marrow stem cells, provide a robust system for studying MAGT1's role in differentiation and cellular functions . Manipulating extracellular magnesium concentrations in conjunction with MAGT1 expression modulation offers insights into the relationship between environmental conditions and MAGT1 function . For more advanced genetic manipulation, CRISPR-Cas9 techniques similar to those developed for human MAGT1 could be adapted for rat models, allowing precise genome editing to investigate MAGT1 function . Additionally, the use of fluorescently tagged recombinant MAGT1 can help visualize its subcellular localization and trafficking in live rat cells. Quantitative assays measuring magnesium uptake and intracellular concentrations provide functional data on MAGT1 activity under various experimental conditions.

How do post-translational modifications affect MAGT1 function in rat cells?

Post-translational modifications significantly impact MAGT1 function, though this area remains somewhat underexplored in rat models specifically. N-glycosylation of MAGT1 appears to be crucial for its proper folding, trafficking to the plasma membrane, and function as a magnesium transporter . MAGT1 itself may also participate in the N-glycosylation of other proteins through its association with N-oligosaccharyl transferase complexes, creating an interesting functional duality . Phosphorylation events may regulate MAGT1 activity in response to changing cellular conditions or signaling pathways, though the specific kinases involved and phosphorylation sites in rat MAGT1 require further characterization. Potential ubiquitination sites could influence MAGT1 turnover and degradation rates, affecting its steady-state levels in the cell. Research examining these modifications in rat cells specifically would provide valuable insights into species-specific regulatory mechanisms of MAGT1 function.

What is known about the regulation of MAGT1 expression in rat cells under different physiological and pathological conditions?

MAGT1 expression in rat cells is dynamically regulated under various physiological and pathological conditions. During osteogenic differentiation of rat bone marrow stem cells, MAGT1 expression increases significantly, suggesting developmental regulation of this gene . Magnesium availability appears to influence MAGT1 expression through feedback mechanisms, with altered expression patterns observed under low extracellular magnesium conditions . While not specifically documented in rat models, studies in other systems suggest that inflammatory conditions might affect MAGT1 expression, similar to how cytokines influence other ion channels and transporters . Oxidative stress conditions may also modulate MAGT1 expression and function, though this relationship requires further investigation in rat models. The transcriptional and post-transcriptional regulatory mechanisms controlling MAGT1 expression in rat cells remain largely unexplored and represent an important area for future research.

What are the optimal protocols for producing recombinant rat MAGT1 protein for experimental studies?

Several expression systems have been successfully employed for producing recombinant MAGT1 protein, each with distinct advantages depending on research requirements. For mammalian expression, HEK-293 cells have proven effective for producing correctly folded and post-translationally modified rat MAGT1, which is critical for functional studies . The optimal approach involves cloning the codon-optimized rat MAGT1 cDNA into an appropriate mammalian expression vector containing a purification tag (commonly His-tag or Strep-tag) . Cell-free protein synthesis (CFPS) systems offer an alternative for producing MAGT1 with >70-80% purity, suitable for applications where post-translational modifications are less critical . For larger-scale production, yeast expression systems can generate recombinant MAGT1 with >90% purity, particularly useful for structural studies . The choice of expressing full-length MAGT1 versus specific domains (e.g., AA 66-131) depends on the research question, with truncated versions often showing better expression yields but potentially lacking full functionality . Purification typically employs affinity chromatography based on the incorporated tag, followed by size exclusion chromatography to achieve high purity for downstream applications.

What techniques are most effective for measuring MAGT1 function in rat cells?

Multiple complementary techniques can be employed to comprehensively assess MAGT1 function in rat cells. Magnesium flux assays using fluorescent indicators (such as Mag-fura-2) allow real-time measurement of intracellular magnesium concentrations in response to various stimuli or MAGT1 manipulations. Patch-clamp electrophysiology provides detailed information on MAGT1-mediated magnesium currents across the cell membrane, though this technique is technically challenging. For measuring MAGT1's role in osteogenic differentiation, quantification of osteogenic markers (ALP, OCN, COL-1, RUNX2) by qPCR and Western blotting provides indirect but informative assessment of MAGT1 function . Alizarin Red staining can quantify matrix mineralization as a functional readout in bone-forming cells . To assess MAGT1's potential role in glycosylation, lectin binding assays or mass spectrometry-based glycoproteomic approaches can detect alterations in protein glycosylation patterns. Combining these approaches with genetic manipulation of MAGT1 (knockdown, overexpression, or mutation) provides comprehensive insights into its functional roles in rat cells.

How can CRISPR-Cas9 genome editing be optimized for studying MAGT1 in rat models?

CRISPR-Cas9 genome editing offers powerful approaches for studying MAGT1 in rat models, with several optimization strategies enhancing efficiency and specificity. Based on approaches developed for human MAGT1, researchers should design multiple sgRNAs targeting exon 1 or other critical regions of the rat MAGT1 gene, followed by validation to identify those with highest cutting efficiency (>70% is achievable with optimization) . For knock-in experiments, homology-directed repair (HDR) templates containing rat MAGT1 cDNA flanked by homology arms (typically 800bp) can be delivered via adeno-associated virus (AAV) vectors, which have shown superior efficiency in similar applications . Enhancing HDR while suppressing non-homologous end joining can significantly improve precise editing, potentially through transient modulation of DNA repair pathways as demonstrated in human cells . For primary rat cells, optimization of electroporation parameters is critical, with recommended settings of 25 μg/mL Cas9 mRNA and approximately 2% glycerol in the electroporation buffer to maximize cell viability and editing efficiency . Off-target effects should be systematically evaluated using techniques such as CHANGE-seq (circularization for high-throughput analysis of nuclease genome-wide effects by sequencing) to ensure experimental validity .

What experimental design considerations are important when studying MAGT1's role in magnesium homeostasis in rat tissues?

When designing experiments to study MAGT1's role in magnesium homeostasis in rat tissues, several critical factors must be considered. Tissue-specific expression patterns of MAGT1 and other magnesium transporters should be characterized to provide context for functional studies . Experimental designs should include both gain-of-function (overexpression) and loss-of-function (knockdown/knockout) approaches to comprehensively assess MAGT1's contribution to magnesium homeostasis. Magnesium concentration in experimental media must be precisely controlled, as slight variations can significantly impact cellular responses and potentially mask MAGT1-specific effects . When manipulating extracellular magnesium, researchers should establish dose-response relationships rather than single concentrations to capture the full spectrum of MAGT1 activity. Time-course experiments are essential to distinguish between acute and chronic effects of MAGT1 modulation on magnesium homeostasis. For in vivo studies, dietary magnesium content should be carefully controlled, with monitoring of serum and tissue magnesium levels throughout the experiment . Control experiments should account for compensatory mechanisms involving other magnesium transporters that might activate in response to MAGT1 manipulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.