Recombinant Rat Mas-related G-protein coupled receptor member A (Mrgpra)

Shipped with Ice Packs
In Stock

Description

Introduction to Mrgpra

Mrgpra belongs to the Mas-related G protein-coupled receptor (MRGPR) family, which regulates sensory and immune responses. This receptor is predominantly expressed in dorsal root ganglia (DRG) neurons and mast cells, playing roles in nociception, itch perception, and neuro-immune interactions . Recombinant Rat Mrgpra enables precise investigation of these pathways by providing a controlled, purified protein variant .

Functional Roles

Recombinant Rat Mrgpra has been implicated in:

  • Sensory Modulation: Mediates non-histaminergic itch and pain signals via interactions with neuropeptides (e.g., β-alanine) .

  • Immune Regulation: Activates mast cells, triggering degranulation and cytokine release in response to pathogens or allergens .

  • Ligand Specificity: Binds cationic peptides and small molecules, though its exact endogenous ligands remain under investigation .

Studies in analogous human MRGPRX1 suggest that recombinant receptors can inhibit calcium channels to attenuate pain signals, highlighting therapeutic potential .

Key Findings Using Recombinant Mrgpra

  • Mechanistic Studies: Used in calcium flux and BRET assays to map signaling pathways (e.g., Gαi protein activation) .

  • Drug Discovery: Screens for ligands or modulators targeting chronic pain or inflammatory diseases .

  • Pathogen Response: Identified roles in bacterial quorum-sensing molecule detection, enhancing neutrophil recruitment .

Challenges

  • Species-Specificity: Rat Mrgpra shares limited homology with human MRGPRs, complicating translational studies .

  • Ligand Promiscuity: Interacts with diverse ligands, requiring careful validation to avoid off-target effects .

Comparative Insights

FeatureRat MrgpraHuman MRGPRX1
ExpressionDRG neurons, mast cells Nociceptive neurons, mast cells
Ligandsβ-alanine, RF-amide peptides BAM8–22, neuropeptides
Therapeutic TargetItch, bacterial immunity Chronic pain

Future Directions

Current research focuses on:

  • Resolving high-resolution structures to guide drug design.

  • Developing in vivo models (e.g., humanized mice) to bridge rodent-human translational gaps .

  • Exploring roles in chronic inflammatory conditions like rosacea, where MRGPR pathways are dysregulated .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mrgpra; Mrga; Mas-related G-protein coupled receptor member A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mrgpra
Target Protein Sequence
MDKTIPGSFNSRTLIPNLLIIISGLVGLIGNAMVFWLLGFRLARNAFSVYILNLALADFL FLLCHIIDSTLLLLKFSYPNIIFLPCFNTVMMVPYIAGLSMLSAISTERCLSVVCPIWYR CRRPKHTSTVMCSAIWVLSLLICILNRYFCGFLDTKYEKDNRCLASNFFTAACLIFLFVV LCLSSLALLVRLFCGAGRMKLTRLYATIMLTVLVFLLCGLPFGIHWFLLIWIKIDYGKFA YGLYLAALVLTAVNSCANPIIYFFVGSFRHQKHQTLKMVLQRALQDTPETAENTVEMSSS KVEP
Uniprot No.

Target Background

Function

The Mas-related G-protein coupled receptor member A (Mrgpra) is an orphan receptor activated by specific RFamide-family neuropeptides, such as FLRF-amide and FMRF-amide. It exerts its effects through G protein association, activating a phosphatidylinositol-calcium second messenger system. Signaling is mediated by Gq and G11 proteins. Mrgpra may regulate nociceptive neuron function, influencing pain perception.

Gene References Into Functions
  1. Kinetics of adenine binding to the adenine receptor of the rat brain cortex. PMID: 15604413
  2. Results validate the predicted structure for MrgA and should be useful for seeking other small molecule agonists and antagonists. PMID: 17728165
Database Links
Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of IB4-positive small diameter nociceptive dorsal root neurons.

Q&A

What is the Mrgpr family and where is Mrgpra expressed in rats?

The Mas-related G protein-coupled receptors (Mrgprs) comprise a subfamily of GPCRs with almost 40 members grouped into nine distinct subfamilies (MRGPRA to -H and -X). Most members of this family, including all MRGPRA subfamily receptors, are nearly exclusively expressed in specific dorsal root ganglia (DRG) and trigeminal ganglia neurons . This expression pattern suggests their important roles in nociception, itch/pruritus, and thermosensation processes . In rats specifically, Mrgpra receptors are predominantly found in small-diameter sensory neurons that function as nociceptors, though expression patterns can vary between different Mrgpra subtypes.

What signaling pathways are activated by rat Mrgpra receptors?

Rat Mrgpra receptors primarily signal through G-protein dependent pathways. While specific signaling mechanisms for each Mrgpra subtype are still being characterized, studies of related Mrgpr family members suggest they can couple to multiple G-protein subtypes. For example, MRGPRD (another family member) signals through both Gq and Gi proteins, leading to changes in intracellular Ca²⁺ and cAMP levels . By analogy, Mrgpra receptors likely activate similar pathways, potentially contributing to neuronal excitability and sensitization in sensory neurons. In some contexts, activation of Mrgpr family receptors can lead to ERK1/2 activation and induce the early growth response protein-1, which plays a significant role in the development of inflammatory pain .

What are the known ligands for rat Mrgpra receptors?

While many Mrgpr family members remain "orphan" receptors without identified endogenous ligands, several potential activating compounds have been identified across the broader family . For the rat Mrgpra subfamily specifically, endogenous peptide fragments derived from proenkephalin A metabolism have been investigated as potential ligands. Other Mrgpr family members respond to compounds such as β-alanine (MRGPRD), BAM22 (MRGPRX1), and various antimicrobial peptides like β-defensins and cathelicidins (MRGPRX2) . Experimental approaches to identify specific ligands for rat Mrgpra subtypes often employ functional assays measuring calcium mobilization, receptor internalization, or downstream signaling pathway activation in recombinant expression systems.

How do rat Mrgpra receptors differ from other Mrgpr subfamilies?

The Mrgpr family is characterized by substantial diversity both between and within species. Rat Mrgpra receptors differ from other subfamilies in several key aspects:

  • Sequence homology: Rat Mrgpra receptors share higher sequence homology within their subfamily than with other Mrgpr subfamilies

  • Expression patterns: While most Mrgpr subfamilies are expressed in sensory neurons, specific expression patterns vary between subfamilies

  • Ligand specificity: Different Mrgpr subfamilies respond to distinct ligands, with MRGPRD recognizing β-alanine and MRGPRX1 being activated by BAM22

  • Species distribution: Some subfamilies show significant species differences, with the MRGPRX subfamily being primate-specific while MRGPRA is present in rodents

These differences highlight the importance of studying specific subfamilies in appropriate animal models when investigating their physiological roles.

What techniques are most effective for generating recombinant rat Mrgpra for functional studies?

For generating recombinant rat Mrgpra proteins for functional studies, several expression systems have proven effective, each with distinct advantages:

  • Mammalian cell expression systems: HEK293 and F11 (DRG neuron-derived) cell lines have been successfully used for recombinant expression of related Mrgpr family members . These systems provide appropriate post-translational modifications and cellular machinery for proper receptor folding and trafficking.

  • Primary neuron cultures: Cultured rat DRG neurons provide a more physiologically relevant system for studying Mrgpra function in their native cellular environment .

  • Receptor tagging strategies: For detection and purification purposes, epitope tags (such as HA, FLAG, or His tags) can be added to the N-terminus or C-terminus of the receptor, though care must be taken to ensure tags don't interfere with receptor function.

When designing expression constructs, researchers should consider codon optimization for the host expression system and inclusion of appropriate regulatory elements to ensure robust expression. Verification of successful expression typically involves immunohistochemistry, Western blotting, or functional assays measuring ligand-induced responses.

How do posttranslational modifications affect rat Mrgpra function?

Posttranslational modifications (PTMs) significantly impact GPCR function, including rat Mrgpra receptors. Key considerations include:

  • N-linked glycosylation: Potential N-glycosylation sites in the extracellular domains may affect receptor stability, trafficking, and ligand binding properties.

  • Phosphorylation: Phosphorylation of intracellular domains, particularly the third intracellular loop and C-terminal tail, regulates receptor desensitization, internalization, and coupling to signaling pathways. Protein kinase C (PKC) activation has been studied in the context of other Mrgpr family members, though its specific effects on Mrgpra function require further investigation .

  • Palmitoylation: This lipid modification can anchor portions of the receptor to the plasma membrane, affecting receptor conformation and signaling capabilities.

Experimental approaches to study PTM effects include site-directed mutagenesis of modification sites, pharmacological inhibition of modifying enzymes, and mass spectrometry-based proteomic analysis to identify and quantify specific modifications.

What methodological approaches are recommended for studying rat Mrgpra in vivo?

For investigating rat Mrgpra function in vivo, several complementary approaches are recommended:

  • Immunohistochemistry: Confocal immunohistochemistry using antibodies against rat Mrgpra can reveal expression patterns in tissues such as DRG and dermal nerve fibers . Co-localization studies with markers like isolectin B4, TRPV1, and CGRP provide insights into the neuronal populations expressing Mrgpra .

  • Electrophysiological recordings: Single-fiber recordings from receptive fields treated with potential Mrgpra ligands can assess functional responses in sensory neurons .

  • Neurochemical assays: Measuring neuropeptide release (e.g., CGRP) from isolated tissues like hind-paw skin or sciatic nerve provides functional readouts of Mrgpra activation .

  • Behavioral assays: Tests for pain, itch, and thermal sensitivity in rats can assess the functional consequences of Mrgpra modulation in vivo.

  • Genetic approaches: With the improved rat reference genome (mRatBN7.2), more precise genetic manipulation approaches become feasible, including targeted gene knockout or knockin strategies .

When designing in vivo experiments, researchers should consider strain differences, as genetic variations across rat strains may affect Mrgpra expression and function .

How does heterodimerization affect rat Mrgpra signaling and function?

GPCRs, including Mrgpr family members, can form homo- and heterodimers that influence receptor pharmacology and signaling. For rat Mrgpra receptors:

  • Potential dimerization partners: Mrgpra receptors may form heterodimers with other Mrgpr subtypes or different GPCR families. Within the Mrgpr family, MRGPRE has been observed to bind MRGPRD to form heterodimers , suggesting similar interactions may occur with Mrgpra receptors.

  • Functional consequences: Dimerization can alter ligand binding affinity, signaling pathway selection, receptor trafficking, and desensitization properties.

  • Experimental approaches: To study Mrgpra dimerization, techniques include:

    • Bioluminescence/fluorescence resonance energy transfer (BRET/FRET)

    • Co-immunoprecipitation of differentially tagged receptors

    • Functional complementation assays

    • Proximity ligation assays in native tissues

Understanding the dimerization profile of Mrgpra receptors may provide insights into their complex signaling properties and potentially reveal novel therapeutic targets.

What are the implications of rat Mrgpra in pain processing and nociception?

Rat Mrgpra receptors, like other members of the Mrgpr family, are predominantly expressed in nociceptive neurons and likely play significant roles in pain processing:

  • Nociceptive signaling: Studies of related Mrgpr family members show their activation can induce acute pain and contribute to sensitization mechanisms . Mrgpr activation can enhance the heat-induced and capsaicin-induced release of neuropeptides like CGRP from sensory neurons .

  • Inflammatory pain: Some Mrgpr family members activate ERK1/2 signaling pathways and induce early growth response protein-1, known to play significant roles in the development of inflammatory pain .

  • Neuropathic pain: Mrgpr-induced upregulation of chemokine receptor 2 (CCR2) represents a potential mechanism contributing to neuropathic pain development . This pathway represents a previously unidentified signaling circuit that enhances chemokine signaling by acting on distinct yet functionally cooperating cell types .

  • Thermal sensitivity: Activation of certain Mrgpr receptors can sensitize responses to thermal stimuli, though interestingly, this sensitization may occur through mechanisms independent of TRPV1, despite frequent co-expression of these receptors .

Understanding these mechanisms provides potential targets for novel pain management strategies, particularly for pain conditions resistant to current therapeutic approaches.

What control experiments are essential when studying recombinant rat Mrgpra?

When designing experiments with recombinant rat Mrgpra, several controls are essential:

  • Expression verification controls:

    • Empty vector transfections to control for transfection effects

    • Western blot or immunocytochemistry to confirm receptor expression

    • Cell surface ELISA to quantify receptor expression levels

  • Pharmacological controls:

    • Concentration-response curves for putative ligands

    • Competitive binding assays with known ligands

    • Vehicle controls for all treatments

    • Antagonist controls to confirm receptor-specificity of responses

  • Signaling pathway controls:

    • Positive controls using receptors with well-characterized signaling

    • Pathway inhibitors to confirm specificity of signaling readouts

    • Controls for potential crosstalk with endogenous receptors

  • Specificity controls:

    • Tests with related but distinct Mrgpr subtypes

    • Mutant receptor controls with key residues altered

    • Cross-species comparisons when appropriate

These controls help ensure that observed effects are specific to rat Mrgpra activation rather than artifacts of the experimental system or non-specific effects of test compounds.

How can ligand selectivity for rat Mrgpra be accurately determined?

Determining ligand selectivity for rat Mrgpra requires a multi-faceted approach:

  • Binding assays:

    • Competitive binding assays with radiolabeled or fluorescently labeled ligands

    • Saturation binding to determine affinity constants

    • Kinetic binding studies to assess association/dissociation rates

  • Functional selectivity assessment:

    • Calcium mobilization assays

    • cAMP accumulation assays

    • β-arrestin recruitment assays

    • ERK phosphorylation assays

  • Cross-reactivity testing:

    • Parallel testing against related Mrgpr subtypes

    • Screening against known GPCRs with similar ligand preferences

    • Testing in cells lacking Mrgpra expression

  • In silico approaches:

    • Molecular docking simulations

    • Structure-activity relationship studies

    • Pharmacophore modeling based on known ligands

A comprehensive approach combining these methods provides the most reliable assessment of ligand selectivity profiles for rat Mrgpra receptors.

What challenges exist in translating rat Mrgpra research to human applications?

Several significant challenges exist in translating findings from rat Mrgpra research to human applications:

  • Species differences:

    • The MRGPRA subfamily in rats differs significantly from human MRGPRs

    • Humans possess MRGPRX subfamily members that are primate-specific

    • Sequence homology between species varies considerably across the Mrgpr family

  • Pharmacological differences:

    • Ligand selectivity profiles may differ between species

    • Potency and efficacy of compounds often vary across species orthologs

    • Human-specific ligands may not activate rat receptors and vice versa

  • Expression pattern differences:

    • While generally expressed in sensory neurons across species, the specific neuronal populations may differ

    • Co-expression with other receptors and signaling molecules may vary

  • Functional differences:

    • Signaling pathway coupling may differ between species

    • Physiological roles may have evolved differently across species

  • Experimental limitations:

    • Difficulty in obtaining human primary sensory neurons for research

    • Limitations of heterologous expression systems in recapitulating native receptor function

To address these challenges, researchers should consider:

  • Comparing rat and human receptor pharmacology in parallel experiments

  • Using humanized animal models where appropriate

  • Developing in vitro systems with human neurons derived from stem cells

  • Correlating findings with clinical observations in human pain conditions

How do genetic variations in rat Mrgpra affect receptor function across different rat strains?

With the improved rat reference genome (mRatBN7.2), our understanding of genetic variations affecting Mrgpra function has advanced significantly:

  • Strain-specific variations:

    • Analysis of 163 whole genome sequencing datasets representing 120 laboratory rat strains has identified approximately 20 million sequence variations

    • Of these, 18.7 thousand variations potentially impact the function of 6,677 genes

    • Specific variations affecting Mrgpra genes may contribute to strain differences in pain sensitivity and responses to inflammatory stimuli

  • Functional consequences:

    • Coding region variations may alter ligand binding properties or G-protein coupling efficiency

    • Promoter region variations could affect expression levels in specific neuronal populations

    • Variations in regulatory elements may influence receptor expression in response to inflammatory stimuli or injury

  • Experimental approaches:

    • Comparative pharmacology across different rat strains

    • Correlation of genetic variations with phenotypic differences in pain models

    • Recombinant expression of variant receptors to assess functional differences

  • Implications for research:

    • Choice of rat strain for pain research should consider genetic background

    • Heterogeneous stock rats, derived from eight inbred strains, provide a valuable resource for mapping traits related to Mrgpra function

    • The Hybrid Rat Diversity Panel allows generation of over 10,000 isogenic F1 hybrids for comparative studies

Understanding these strain differences is crucial for experimental design and interpretation of results in rat models of pain and inflammation.

What are the potential therapeutic applications targeting rat Mrgpra in disease models?

Research on rat Mrgpra receptors provides insights into potential therapeutic applications:

  • Pain management:

    • Targeting Mrgpra may provide novel approaches for treating pain conditions resistant to current therapies

    • The involvement of Mrgpr family members in both acute pain and sensitization mechanisms suggests potential for both symptomatic treatment and disease modification

  • Neuroinflammatory conditions:

    • Mrgpr-mediated regulation of neurogenic inflammation through neuropeptide release suggests applications in inflammatory pain conditions

    • The link between Mrgpr activation and CCR2 upregulation points to potential interventions in chemokine-promoted pain

  • Pruritus (itch):

    • Mrgpr family members play important roles in itch sensation, suggesting potential applications in pruritic conditions

  • Cardiovascular and metabolic diseases:

    • Some Mrgpr family members are expressed in cardiovascular organs and show protective effects in cardiovascular and metabolic diseases

  • Experimental approaches:

    • Developing selective agonists or antagonists for specific Mrgpra subtypes

    • Testing compounds in rat models of inflammatory and neuropathic pain

    • Investigating effects on chemokine signaling pathways implicated in chronic pain

While most research remains at the preclinical stage, the diverse roles of Mrgpra receptors in sensory processing and inflammation highlight their potential as therapeutic targets.

How does the coexpression of Mrgpra with other receptors influence experimental design?

The coexpression of Mrgpra with other receptors significantly impacts experimental design and interpretation:

  • Common coexpression patterns:

    • In DRG neurons, Mrgpr family members are frequently coexpressed with markers like isolectin B4 (46% coexpression) and TRPV1 (52% coexpression)

    • Calcitonin gene-related peptide (CGRP) is rarely colocalized with some Mrgpr subtypes in DRG (11%) and dermal nerve fibers (6%)

  • Functional interactions:

    • Mrgpr activation can sensitize TRPV1-mediated responses, though potentially through indirect mechanisms

    • Complex interactions between Mrgpr signaling and opioid receptor pathways, as evidenced by enhanced effects of BAM22 when combined with naloxone

  • Experimental considerations:

    • Need for controls to distinguish direct Mrgpra effects from secondary effects on other receptors

    • Importance of characterizing the specific neuronal populations under study

    • Potential confounding effects when using broad agonists like BAM22 that may activate multiple receptor types

  • Advanced approaches:

    • Single-cell RNA sequencing to precisely characterize receptor coexpression patterns

    • FRET/BRET studies to investigate direct receptor interactions

    • Combinatorial pharmacological approaches targeting multiple coexpressed receptors

Understanding these coexpression patterns enables more precise targeting of specific neuronal subpopulations and interpretation of complex physiological responses.

How should researchers resolve conflicting data on rat Mrgpra signaling mechanisms?

When facing conflicting data regarding rat Mrgpra signaling mechanisms, researchers should employ a structured approach:

  • Systematic analysis of experimental differences:

    • Cell type differences: Responses in recombinant systems may differ from native neurons

    • Expression level variations: Receptor overexpression can alter coupling efficiency to different pathways

    • Methodological differences: Assay sensitivity and temporal resolution vary between techniques

  • Consideration of receptor complexes:

    • Heterodimerization with other receptors may alter signaling profiles

    • Scaffolding proteins may differ between experimental systems

    • Expression of regulatory proteins (GRKs, arrestins) varies between cell types

  • Resolution approaches:

    • Side-by-side comparison using standardized protocols

    • Simultaneous measurement of multiple signaling pathways

    • Single-cell analysis to account for cellular heterogeneity

    • Genetic approaches to validate key signaling components

  • Case study example:

    • Studies of Mrgpr agonist BAM22 show complex effects that appear MrgC-unrelated in some contexts

    • The sensitizing effect on heat-induced responses is unusually resistant to pharmacological interventions

    • Such conflicts can be resolved by careful pharmacological dissection and genetic approaches

Acknowledging the complexity of GPCR signaling, researchers should consider that apparently conflicting data may reflect the true multifaceted nature of receptor function rather than experimental error.

What are the key considerations when analyzing Mrgpra expression data across different experimental platforms?

Analyzing Mrgpra expression data requires careful consideration of platform-specific factors:

  • RNA-based methods:

    • qPCR: Primer design is critical due to sequence similarity between Mrgpr subtypes

    • RNA-Seq: Mapping accuracy is improved with the new rat reference genome (mRatBN7.2)

    • In situ hybridization: Probe specificity must be rigorously validated

  • Protein detection methods:

    • Antibody specificity: Cross-reactivity between closely related Mrgpr subtypes is common

    • Western blotting: Glycosylation can cause variable migration patterns

    • Immunohistochemistry: Fixation and permeabilization protocols affect epitope accessibility

  • Cross-platform comparison challenges:

    • mRNA levels may not correlate with protein expression

    • Different sensitivity thresholds between methods

    • Spatial resolution varies between techniques

  • Normalization and quantification:

    • Selection of appropriate reference genes for qPCR

    • Accounting for background in imaging-based approaches

    • Statistical approaches for RNA-Seq normalization

  • Experimental design recommendations:

    • Validation with multiple methods

    • Inclusion of positive and negative control tissues

    • Use of genetic models (knockout/knockin) as specificity controls

    • Careful documentation of rat strain, age, and tissue preparation methods

The improved rat reference genome assembly (mRatBN7.2) significantly enhances the mapping precision of genomic, transcriptomic, and proteomics data sets, reducing previous limitations in rat Mrgpra expression analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.