Recombinant Rat Mas-related G-protein coupled receptor member B5 (Mrgprb5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mrgprb5; Mrgb5; Mas-related G-protein coupled receptor member B5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mrgprb5
Target Protein Sequence
MPDSPTESYGPDREYHVFISLFLCRNTSGKFLSVGPATPGWSINNTVVKENYYTEKLSCI ITFNTLNFLTATISVVGTAGNATVLRLLGFHMHRYAFSVYVFNLAGADFLYLCTQTVYSL ECVLQFDNSYFYFLLTILMFAYLAALCMIPAISTERCLSVTWPIWYHCQRPRHTSATVCA LFWAFSLLLRLLLGQGCGFLFGKYDYYFCRYCSFITTAFLIVLFVVPFVSSLAMLTKIIC GSHRIPVTRFYVTIAVTVLVFTFFGLPVGIISLLLPRIVVFRGVFYIYKIVTFLYSVNCC ANPIIYFLIGSIRHHRLQRQSLKLLLQRAMQDTPEEEGGVKGPSQKSNELEIV
Uniprot No.

Target Background

Function
Orphan receptor. Likely involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain.
Database Links

KEGG: rno:404644

UniGene: Rn.141968

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed strongly in newborn dorsal root ganglia, adult dorsal root ganglia and trigeminal ganlia.

Q&A

What is Mrgprb5 and how does it relate to sensory neuron function?

Mrgprb5 belongs to the Mas-related G protein-coupled receptor (Mrgpr) family, which are exclusively expressed in peripheral sensory neurons. These receptors function primarily as mediators of somatosensation, particularly itch sensation. While specific Mrgprs like MrgprA3 (mouse) and MrgprX1 (human) have been directly linked to chloroquine-induced itch, Mrgprb5's precise role continues to be investigated. The Mrgpr family generally functions as cell surface receptors that transduce external stimuli into intracellular signaling cascades in sensory neurons .

How does Mrgprb5 compare structurally and functionally to other members of the Mrgpr family?

Mrgprb5 is one of several Mrgpr subfamily members (which include MrgprA, MrgprB, MrgprC, and MrgprX classes). While detailed structural comparisons are ongoing, functional studies indicate that different Mrgpr receptors respond to distinct ligands. For example, mouse MrgprA3 and human MrgprX1 specifically respond to chloroquine, while other Mrgprs are activated by peptides terminating in RF/Y-G or RF/Y-amide (such as FMRFamide, neuropeptide FF, neuropeptide AF, γ2-MSH and BAM) . The B-family members like Mrgprb5 represent a distinct evolutionary branch with potentially specialized functions in rodent sensory neurons.

What are optimal expression systems for studying recombinant Mrgprb5?

Several expression systems have been validated for recombinant Mrgprb5 production, each with distinct advantages:

Expression SystemAdvantagesApplications
Cell-Free ExpressionRapid production, avoids cellular toxicity issuesInitial binding studies, antibody validation
E. coliHigh yield, cost-effectiveStructure-function analysis (with refolding)
Mammalian CellNative post-translational modifications, proper foldingFunctional studies, signaling assays
BaculovirusHigher yield than mammalian with some PTMsStructural studies, large-scale protein production

For functional studies examining receptor activation, mammalian expression systems (particularly HEK293 cells) are preferred as they enable proper membrane localization and coupling to G proteins. Researchers have successfully used GFP-fusion constructs to visualize proper membrane localization without disrupting normal function of Mrgprs .

How can the functional activity of recombinant Mrgprb5 be assessed?

Functional activity of recombinant Mrgprb5 can be assessed through several complementary approaches:

  • Calcium Mobilization Assays: Measure intracellular calcium ([Ca²⁺]ᵢ) changes upon receptor activation using calcium-sensitive dyes or genetically encoded calcium indicators. This approach has been successfully used with other Mrgpr family members, where EC₅₀ values were determined for specific ligands (e.g., EC₅₀ of 27.55 ± 2.03 μM for chloroquine activation of MrgprA3) .

  • Receptor Internalization: Monitor GFP-tagged receptor internalization following agonist exposure using confocal microscopy.

  • G-protein Coupling Analysis: Measure downstream signaling activation through [³⁵S]GTPγS binding assays or phosphorylation of effector proteins.

  • Electrophysiological Recordings: Whole-cell patch-clamp recordings in Mrgprb5-expressing cells to measure activation-induced currents.

What approaches are recommended for MRGPRB5 knockdown studies?

For effective MRGPRB5 knockdown studies, siRNA with high purity (>97%) specifically targeting rat or mouse MRGPRB5 is commercially available . A methodical approach involves:

  • Transfection Optimization: Determine optimal transfection conditions for your specific cell type (concentration, reagent, timing).

  • Validation: Quantify knockdown efficiency through qPCR (mRNA level) and Western blotting (protein level).

  • Controls: Include non-targeting siRNA controls alongside untreated controls.

  • Timing Considerations: Account for protein half-life (typically testing functional effects 48-72 hours post-transfection).

  • Rescue Experiments: Perform rescue experiments with siRNA-resistant Mrgprb5 constructs to confirm specificity of observed effects.

For in vivo applications, consider viral vector-delivered shRNA for longer-term knockdown in specific neuronal populations.

How do culture conditions affect Mrgprb5 expression in primary sensory neurons?

Primary sensory neuron cultures exhibit significant transcriptional alterations compared to native dorsal root ganglia (DRG), which can substantially impact Mrgprb5 expression and functional studies. Research has demonstrated that:

  • DRG neurons in culture develop transcriptional signatures resembling an injury phenotype, with significant upregulation of genes associated with nerve injury or inflammation (BDNF, MMP9, GAL, and ATF3) .

  • The expression profile of many receptors, including GPCRs like Mrgprs, changes significantly during culturing. This has important implications for functional studies using cultured DRG neurons.

For optimal maintenance of physiologically relevant Mrgprb5 expression:

  • Use freshly isolated neurons whenever possible

  • Supplement media with nerve growth factor (5 ng/mL mouse 2.5S NGF)

  • Maintain cultures in DMEM/F12 with GlutaMAX containing 10% FBS

  • Add 5-fluorouridine (3 μg/ml) with uridine (7 μg/ml) to inhibit non-neuronal cell proliferation

  • Consider analyzing expression at multiple time points (1-7 DIV) as transcriptional changes progress over time

What are the critical considerations when comparing Mrgprb5 function across species?

When conducting cross-species Mrgprb5 studies, researchers should address several important considerations:

  • Evolutionary Divergence: Mrgpr genes have undergone significant evolutionary diversification, with considerable differences between rodent and human receptors. For example, while mice express MrgprA3 as their chloroquine receptor, humans utilize MrgprX1, with significantly different potencies (EC₅₀ values of 27.55 ± 2.03 μM versus 297.68 ± 2.10 μM, respectively) .

  • Expression Pattern Differences: The distribution and cell-type specificity of Mrgprb5 may differ between species. Some Mrgpr subtypes are expressed in small-diameter DRG neurons, particularly in peptidergic nociceptors, but precise expression patterns vary between species.

  • Pharmacological Profile Variation: Ligand potency, efficacy, and specificity often differ substantially between species orthologs. Cross-validate findings using recombinant receptors from each species.

  • Genetic Redundancy: Consider functional redundancy among Mrgpr family members when interpreting knockout/knockdown studies.

  • Transcriptional Differences: Gene expression changes in culture conditions can vary between human and mouse DRG neurons, with species-specific upregulation of inflammation-associated genes .

What are common experimental pitfalls when working with recombinant Mrgprb5?

Several common challenges can complicate Mrgprb5 research:

  • Low Surface Expression: GPCRs often express poorly at the cell surface. Optimize codon usage for expression system and consider using signal sequences to enhance membrane trafficking.

  • Receptor Instability: Mrgprs may exhibit instability in certain detergents during purification. Screen multiple detergents at varying concentrations.

  • Constitutive Activity: Background signaling in overexpression systems may occur. Include appropriate controls and consider using inducible expression systems.

  • Functionality Assessment: Verifying that recombinant Mrgprb5 retains native functionality can be challenging without well-characterized specific ligands. Consider chimeric receptor approaches or use of promiscuous G proteins (Gα16) to amplify signaling.

  • Culture-Induced Alterations: When studying Mrgprb5 in primary neurons, be aware that culture conditions significantly alter gene expression patterns compared to native ganglia . This injury-like phenotype may confound interpretation of receptor function.

How can researchers address data inconsistencies in Mrgprb5 signaling studies?

When faced with inconsistent or contradictory data regarding Mrgprb5 signaling:

  • Receptor Expression Variation: Quantify receptor expression levels through ELISA, flow cytometry, or radioligand binding to normalize responses.

  • Cell Line Considerations: Different cell backgrounds can yield varying signaling outcomes. Test multiple cell types and confirm in primary neurons when possible.

  • Signaling Pathway Convergence: Mrgprs may couple to multiple G-proteins or engage several downstream pathways. Employ multiple complementary assay systems targeting different aspects of signaling.

  • Temporal Resolution: Examine different time points, as rapid desensitization or delayed signaling may occur.

  • Cross-Receptor Interactions: Consider heteromerization with other receptors or modulatory effects from endogenous GPCR populations in your model system.

  • Species Differences: Human and rodent receptor orthologs may exhibit fundamentally different pharmacological properties and signaling profiles .

What are emerging areas of Mrgprb5 research with therapeutic potential?

Several promising research directions for Mrgprb5 and related Mrgpr receptors include:

  • Itch-Selective Therapies: Given the role of Mrgprs in non-histaminergic itch, targeting specific receptors could yield treatments for conditions poorly responsive to antihistamines .

  • Pain Modulation: Although acute pain responses appeared normal in Mrgpr-cluster knockout mice, subtle modulation of inflammatory or neuropathic pain states may involve these receptors, as suggested by the modest but statistically significant increases in inflammatory hyperalgesia in these models .

  • Neuron-Specific Drug Delivery: The highly restricted expression of Mrgprs in specific sensory neuron populations makes them potential targets for selective drug delivery.

  • Neuroinflammatory Modulation: Given the inflammation-associated gene changes observed in DRG cultures , investigation of Mrgprb5's role in neuroinflammatory processes may yield new insights.

  • Functional Characterization: Continued efforts to identify endogenous ligands and determine the physiological function of Mrgprb5 specifically, beyond what is known about other family members.

What methodological advances would accelerate Mrgprb5 research?

To advance understanding of Mrgprb5 biology, several methodological developments would be valuable:

  • Specific Antibodies/Nanobodies: Development of highly specific tools for immunolocalization and immunoprecipitation studies.

  • Selective Ligands: Discovery of selective agonists and antagonists to distinguish Mrgprb5 function from related family members.

  • Conditional Knockout Models: Development of sensory neuron subtype-specific and inducible Cre lines for temporal control of Mrgprb5 expression.

  • Advanced Imaging Techniques: Application of super-resolution microscopy and in vivo calcium imaging to study Mrgprb5 localization and activation in intact tissue.

  • Improved Culture Systems: Development of culture conditions that better maintain the native transcriptome of sensory neurons, avoiding the injury-like phenotype currently observed .

  • Single-Cell Analysis: Expanded single-cell transcriptomic and proteomic analysis to better define Mrgprb5-expressing cell populations and their functional significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.