Recombinant Rat Mas-related G-protein coupled receptor member D (Mrgprd)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Mrgprd

Mrgprd (MAS-related G protein-coupled receptor member D) is a seven-transmembrane GPCR predominantly expressed in nociceptive sensory neurons, particularly in dorsal root ganglia (DRG) and trigeminal ganglia . It plays critical roles in pain perception, itch signaling, and neuro-immune interactions. Recombinant rat Mrgprd refers to engineered versions of this receptor used in biochemical assays, structural studies, and therapeutic development.

Experimental Insights

ParameterObservationSource
Mrgprd expressionIncreased in DRG neurons of diabetic mice
Mechanical allodyniaReversed by Mrgprd signaling inhibition
Calcium influxEnhanced in Mrgprd-positive afferents

Mechanistic Link: Activation of Mrgprd-positive cutaneous afferents induces calcium influx in DRG nociceptors, exacerbating hyperexcitability .

Cardiac Pathophysiology

Mrgprd contributes to cardiac remodeling and hypertrophy. In angiotensin II (Ang II)-induced models, Mrgprd overexpression promotes fibrosis and hypertrophy, while its antagonism (e.g., alamandine) mitigates these effects .

Experimental Data

Model/ParameterMrgprd OverexpressionMrgprd Antagonism (Alamandine)Source
Cardiac hypertrophy↑ Nppa/Nppb mRNA, ↓ Myh6/7 ratio↓ Hypertrophy markers
Fibrosis↑ α-SMA, TGF-β, collagen I↓ Fibrotic gene expression
Portal pressure (cirrhosis)↓ Splanchnic vasodilation

Pharmacological Profiling

Recombinant Mrgprd is used in label-free assays to study ligand-receptor interactions. Dynamic mass redistribution (DMR) and calcium imaging reveal distinct G-protein coupling biases .

Assay Comparison

Assay TypeSignaling Pathway DetectedAgonist Potency (β-Alanine)Source
DMR (Gαi-mediated)Gαi-dependent signalingIC50: ~100 μM
Calcium (Gαq-mediated)Gαq-dependent signalingEC50: ~10 μM

Key Observations: β-Alanine exhibits biased signaling, preferentially activating Gαq pathways in calcium assays .

Therapeutic Potential

Mrgprd antagonists are explored for treating neuropathic pain and cardiovascular diseases.

Pain Management

  • Strategy: Targeting Mrgprd to reduce DRG hyperexcitability.

  • Evidence: Limiting Mrgprd signaling reverses mechanical allodynia in diabetic mice .

Cardiovascular Applications

  • Strategy: Blocking Mrgprd to mitigate cardiac hypertrophy and portal hypertension.

  • Evidence: MrgD antagonism (D-Pro) restores splanchnic vascular resistance in cirrhotic rats .

Recombinant Rat Mrgprd: Applications and Tools

Tissue/OrganismExpression ProfileSource
Rat DRGHigh in nociceptors
Rat splanchnic vesselsUpregulated in cirrhosis
Rat myocardiumElevated under Ang II stimulation

Challenges and Future Directions

  • Selectivity: Distinguishing Mrgprd from related receptors (e.g., Mrgpra) in therapeutic contexts .

  • Delivery: Overcoming blood-brain barrier limitations for CNS-targeted therapies.

  • Biomarkers: Developing assays to monitor Mrgprd activity in clinical samples.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag is required, please inform us for preferential development.
Synonyms
Mrgprd; Mrgd; Mas-related G-protein coupled receptor member D; Beta-alanine receptor; G-protein coupled receptor TGR7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MNYTPYSSPAPGLTISPTMDPVTWVYFSVTFLAMATCVCGIVGNSMVIWLLSFHRVQRSP FCTYVLNLAVADLLFLLCMASLLSLETGPLLTASTSARVYEGMKRIKYFAYTAGLSLLTA ISTQRCLSVLFPIWYKCHRPQHLSGVVCGVLWALALLMNFLASFFCVQFWHPDKYQCFKV DMVFNSLILGIFMPVMVLTSAIIFIRMRKNSLLQRRQPRRLYVVILTSVLVFLTCSLPLG INWFLLYWVELPQAVRLLYVCSSRFSSSLSSSANPVIYFLVGSQKSHRLQESLGAVLGRA LQDEPEGRETPSTCTNDGV
Uniprot No.

Target Background

Function
Recombinant Rat Mas-related G-protein coupled receptor member D (Mrgprd) may regulate nociceptor function and/or development, including pain sensation and modulation. It functions as a specific membrane receptor for beta-alanine, coupling with G-proteins G(q) and G(i).
Gene References Into Functions
  1. Activation of recombinant rat MrgD protein promotes the opening of endogenous calcium-activated chloride channels in Xenopus oocytes. PMID: 24078284
  2. MrgD participates in the modulation of neuropathic pain. PMID: 15037633
  3. Interactions between rMrgD and rMrgE modulate rMrgD function. PMID: 16282220
Database Links
Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Co-expressed in the small diameter neurons with P2X3 and VR1 in dorsal root ganglia.

Q&A

Basic Research Questions

  • What is Mrgprd and what is its cellular distribution in sensory neurons?

Mrgprd (Mas-related G protein-coupled receptor member D) is an excitatory G protein-coupled receptor primarily expressed in a distinct subpopulation of nonpeptidergic nociceptors within dorsal root ganglia (DRG). These neurons are polymodal in function, responding to mechanical, thermal, and sometimes cold stimuli, with their peripheral terminals extending to the outermost layer of the skin (epidermis) .

Methodologically, Mrgprd-expressing neurons can be identified using transgenic reporter systems where EGFP (enhanced green fluorescent protein) is inserted into the Mrgprd gene locus, allowing visual identification of these neurons through fluorescence microscopy .

  • What are the established ligands for Mrgprd and their pharmacological properties?

The primary endogenous ligand for Mrgprd is β-alanine. Electrophysiological studies have demonstrated that β-alanine application significantly reduces the rheobase (minimum current threshold required to trigger an action potential) and increases the firing rate in neurons from Mrgprd-expressing mice, with no effect in Mrgprd knockout mice .

Additionally, angiotensin metabolites including Ang(1-7) and alamandine have been identified as potential ligands that can activate Mrgprd, producing responses similar to those mediated by MAS1 receptors .

Pharmacological characterization using different assay systems has revealed some potential antagonists, though with variable efficacy:

CompoundEffect in Ca²⁺ AssaysEffect in DMR AssaysNotes
Thyoradizine hydrochlorideAntagonist activityDifferent inhibition patternAssay-dependent efficacy
MU-6840Antagonist activityDifferent inhibition patternAssay-dependent efficacy
PD123,319No significant effectNo significant effectIneffective as Mrgprd antagonist

Research indicates that there is currently no widely accepted specific inhibitor for Mrgprd, highlighting a significant gap in available pharmacological tools for this receptor .

  • What experimental models are available for studying Mrgprd function?

Several experimental models have been developed to investigate Mrgprd function:

Genetic Models:

  • Mrgprd knockout mice (Mrgprd⁻/⁻): These models have the entire open reading frame of Mrgprd replaced with an in-frame fusion of enhanced green fluorescent protein (EGFP), allowing visualization of cells that would normally express Mrgprd .

  • Mrgprd heterozygous mice (Mrgprd⁺/⁻): These maintain partial Mrgprd expression and allow comparative studies with knockout models .

Cellular Systems:

  • Recombinant expression systems: CHO cells expressing Mrgprd receptors for pharmacological assays .

  • Primary DRG neuron cultures from wild-type and knockout animals .

Ex Vivo Preparations:

  • Skin/nerve/DRG/spinal cord preparations that allow electrophysiological recording from sensory afferents while maintaining their connections to peripheral targets .

Pain Models:

  • High-Fat Diet (HFD) mouse model of painful diabetic neuropathy (PDN) has been used to study Mrgprd's role in neuropathic pain conditions .

These models allow for comprehensive investigation of Mrgprd function from molecular interactions to behavioral outcomes in pain sensation.

  • How does Mrgprd influence neuronal excitability at the cellular level?

Mrgprd functions as a modulator of neuronal excitability through several mechanisms:

  • Action Potential Threshold Regulation: Electrophysiological studies using patch-clamp techniques have demonstrated that Mrgprd activation lowers the threshold for firing action potentials. Specifically, neurons from Mrgprd heterozygous mice (Mrgprd⁺/⁻) show a lower rheobase compared to neurons from knockout mice (Mrgprd⁻/⁻) .

  • Increased Firing Rates: Activation of Mrgprd by β-alanine increases action potential firing rates in Mrgprd-expressing neurons, contributing to enhanced nociceptive signaling .

  • Polymodal Sensitivity Modulation: Mrgprd-expressing neurons respond to multiple stimulus modalities (mechanical, heat, and sometimes cold), and deletion of Mrgprd reduces sensitivity to these stimuli, indicating that the receptor enhances responses across multiple sensory channels .

  • Calcium Influx Amplification: In vivo calcium imaging has revealed that activation of Mrgprd-positive cutaneous afferents results in increased intracellular calcium influx in DRG neurons, particularly in pathological conditions like diabetic neuropathy .

  • G-protein Coupling Diversity: Mrgprd can couple to different G-protein subtypes (Gi and Gq), potentially allowing for diverse cellular responses depending on the cellular context .

These mechanisms collectively contribute to Mrgprd's role in enhancing nociceptor excitability, particularly in pathological pain conditions.

Advanced Research Questions

  • How do different G-protein coupling mechanisms influence Mrgprd signaling outcomes?

Mrgprd exhibits complex signaling characteristics through differential G-protein coupling, which has significant implications for experimental design and data interpretation:

Studies comparing dynamic mass redistribution (DMR) and intracellular calcium release assays have revealed that Mrgprd can couple to both Gi and Gq signaling pathways, but with distinct functional consequences . In DMR assays, which measure global cellular responses to receptor activation, Mrgprd signaling is primarily mediated through Gi-protein coupling. In contrast, intracellular calcium responses are predominantly mediated through Gq-protein coupling .

This differential coupling creates important considerations for pharmacological characterization:

  • Potency Shifts: Agonists typically show approximately one log unit higher potency in calcium assays compared to DMR assays, likely due to signal amplification in the Gq-coupled calcium response pathway .

  • Ligand-Dependent Coupling: Some compounds show different patterns of activity depending on which signaling pathway is being measured, suggesting ligand-biased signaling at the Mrgprd receptor .

  • Inhibitor Efficacy Variation: Putative Mrgprd antagonists like thyoradizine hydrochloride and MU-6840 show different patterns of inhibition between calcium and DMR assays, highlighting the importance of using multiple assay systems for comprehensive pharmacological characterization .

These observations suggest that Mrgprd may adopt different conformational states when coupling to different G-proteins, potentially altering ligand affinity and efficacy. This has significant implications for drug discovery efforts targeting this receptor, as compounds might show pathway-specific effects that wouldn't be captured by single-readout assay systems.

  • What role does Mrgprd play in neuropathic pain conditions, particularly in painful diabetic neuropathy?

Mrgprd has emerged as a key mediator in neuropathic pain conditions, with particularly strong evidence for its role in painful diabetic neuropathy (PDN):

Single-cell RNA sequencing of lumbar dorsal root ganglia (DRG) from mice with PDN has revealed increased expression of Mrgprd in specific neuronal subpopulations . Notably, while Mrgprd is normally expressed primarily in nonpeptidergic type 1 (NP1) neurons under normal conditions, in diabetic mice, it becomes significantly expressed in nonpeptidergic type 2 (NP2) neurons as well .

This expanded expression pattern is particularly significant because:

  • Neuronal Hyperexcitability: Mrgprd is an excitatory receptor with considerable constitutive activity, and its increased expression in additional neuronal populations likely contributes to hyperexcitability in these neurons .

  • Mechanical Allodynia: Limiting Mrgprd signaling has been shown to reverse mechanical allodynia in mouse models of PDN, indicating a causal role for this receptor in pain hypersensitivity .

  • Enhanced Calcium Signaling: In vivo calcium imaging has demonstrated that activation of Mrgprd-positive cutaneous afferents in diabetic mice results in increased intracellular calcium influx in DRG neurons, providing a direct measurement of nociceptor hyperexcitability .

Translational relevance is supported by validation studies in human DRG tissues from both control donors and PDN patients, which have confirmed that MRGPRD is expressed in human DRGs . These findings suggest that Mrgprd-targeted therapies might be applicable to human patients with neuropathic pain conditions.

  • What advanced techniques are being employed to characterize Mrgprd pharmacology and function?

Several sophisticated techniques have been developed to characterize Mrgprd:

Dynamic Mass Redistribution (DMR) Technology:
This label-free technology measures changes in cellular mass distribution within 120-200nm of a gold sensor surface following receptor activation . DMR offers several advantages over traditional assays:

  • It captures the total cellular response to receptor activation without requiring specific pathway-targeted reporters or labels.

  • It allows detection of G-protein coupling preferences that might be missed by single-pathway assays.

  • It provides a bridge between simple second messenger assays and more complex phenotypic assays .

Single-Cell RNA Sequencing:
This technique has been instrumental in identifying changes in Mrgprd expression patterns in pathological conditions:

  • It allows unbiased capture of the complete molecular heterogeneity of DRG neurons.

  • It enables identification of distinct neuronal subtypes and their molecular signatures.

  • It can reveal alterations in receptor expression across different cellular populations in disease states .

In Vivo Calcium Imaging:
This technique allows real-time visualization of neuronal activity:

  • It enables assessment of calcium influx into DRG nociceptors in response to activation of Mrgprd-positive cutaneous afferents.

  • It provides a direct readout of nociceptor excitability in living animals.

  • It allows correlation between receptor activation and functional neuronal responses .

Ex Vivo Skin/Nerve/DRG/Spinal Cord Preparations:
These complex preparations maintain the anatomical connections between peripheral targets and sensory neurons:

  • They allow electrophysiological recording from identified sensory afferents while maintaining their connections to skin.

  • They enable characterization of responses to natural stimuli (mechanical, thermal) in identified neuronal populations.

  • They bridge the gap between cellular and behavioral studies .

  • How can researchers effectively target and manipulate Mrgprd in experimental settings?

Effectively targeting Mrgprd in experimental settings requires a multi-faceted approach:

Genetic Approaches:

  • Knockout Models: Mrgprd⁻/⁻ mice with the entire open reading frame replaced by EGFP allow complete elimination of receptor function while enabling visualization of cells that would normally express it .

  • Heterozygous Models: Mrgprd⁺/⁻ mice provide a system with reduced but not eliminated receptor expression, allowing dose-dependent studies .

Pharmacological Approaches:

  • Agonist Studies: β-alanine serves as a reliable agonist for Mrgprd activation, with clear effects on neuronal excitability that are absent in knockout animals .

  • Antagonist Limitations: Currently available antagonists like thyoradizine hydrochloride and MU-6840 show variable efficacy across different assay systems, highlighting the need for multiple readouts when evaluating compound effects .

Functional Readouts:

  • Electrophysiological Parameters: Researchers can assess Mrgprd function by measuring changes in rheobase, action potential firing rates, and responses to thermal and mechanical stimuli .

  • Calcium Imaging: Changes in intracellular calcium levels provide a quantifiable readout of Mrgprd-mediated neuronal activation .

  • Dynamic Mass Redistribution: This technique provides a holistic view of cellular responses to Mrgprd activation or inhibition .

Behavioral Models:

  • Mechanical Allodynia: Von Frey testing in models of neuropathic pain (like PDN) can assess the functional consequences of Mrgprd manipulation on pain behaviors .

  • Thermal Sensitivity: Hot plate or Hargreaves tests can evaluate Mrgprd's contribution to thermal nociception .

When designing experiments to target Mrgprd, researchers should consider the potential for differential G-protein coupling and the possibility that results may vary depending on the assay system employed. Ideally, multiple complementary approaches should be used to provide comprehensive characterization.

  • What are the translational aspects of Mrgprd research from rodent models to human applications?

Translating Mrgprd research from rodent models to human applications involves several key considerations:

Expression Pattern Differences:
While Mrgprd is expressed in both rodent and human DRGs, there are important species differences in neuronal subpopulations and co-expression patterns . Human DRG neurons show broader expression of certain receptors like TRPV1 compared to mouse DRGs . RNAscope validation studies have confirmed MRGPRD expression in human DRGs from both control donors and patients with painful diabetic neuropathy (PDN) .

Therapeutic Accessibility:
Mrgprd represents a particularly attractive therapeutic target because:

  • It is expressed by nociceptive neurons that extend to the outermost layer of the skin, making it accessible for topical or peripheral interventions .

  • It is a highly druggable G protein-coupled receptor with established ligand binding capabilities .

  • It shows increased expression in pathological pain conditions, potentially providing disease specificity .

Pharmacological Considerations:
When developing Mrgprd-targeted therapeutics for human use, researchers must consider:

  • Signaling Complexity: The ability of Mrgprd to couple to multiple G-protein pathways (Gi and Gq) might affect drug efficacy and side effect profiles .

  • Ligand-Specific Effects: Different ligands may show biased signaling through specific pathways, potentially allowing selective modulation of particular outcomes .

  • Orthogonal Screening Approaches: Using multiple assay technologies like DMR alongside traditional second messenger assays provides more comprehensive characterization of compound effects .

Translational AspectRodent ModelsHuman Considerations
Expression PatternPrimarily in NP1 neurons; expands to NP2 in PDNConfirmed in human DRGs; broader co-expression with TRPV1
Molecular StructureWell-characterized in recombinant systemsMay have subtle structural differences affecting ligand binding
Functional RoleMediates mechanical and thermal sensitivityLikely similar role in nociception, validated in human PDN samples
Therapeutic PotentialLimiting signaling reverses mechanical allodynia in PDNHighly accessible target for peripheral interventions

Successful translation will require continued validation of findings in human tissues and careful consideration of species differences in receptor expression, distribution, and signaling characteristics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.