Recombinant Rat Mas-related G-protein coupled receptor member E (Mrgpre)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Rat Mas-related G-protein coupled receptor member E (Mrgpre) is a laboratory-engineered protein derived from the Mrgpre gene (GPR167, MRGE), which belongs to the Mas-related G-protein coupled receptor (MRGPR) family . These receptors are predominantly expressed in nociceptive neurons and play critical roles in itch, pain sensation, and neuroimmune interactions . Recombinant Mrgpre enables researchers to study its structure, ligand interactions, and downstream signaling in controlled experimental settings.

Production and Expression Systems

Recombinant Mrgpre is produced using various expression platforms to ensure functionality:

  • E. coli Systems: Widely used for cost-effective production (e.g., CSB-CF742495RA) .

  • Mammalian and Baculovirus Systems: For post-translational modifications .

Table 3: Key Research Findings

Study FocusFindingSource
BAM22 SensitivityEnhances CGRP release via Mrgpre
Knockout PhenotypeProlonged pain hypersensitivity in mice

Pharmacological Significance

  • Drug Discovery: MRGPRs are explored for non-opioid analgesics due to their restricted expression in sensory neurons .

  • Challenges: High sequence diversity across species complicates translational research .

Challenges and Future Directions

  • Structural Studies: No inactive-state structures are available, limiting mechanistic insights .

  • Ligand Specificity: Polymorphisms and species-specific variations necessitate tailored agonist design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare it according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing it according to your specification.
Synonyms
Mrgpre; Mrge; Mas-related G-protein coupled receptor member E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSLRVHTHSPSTQGDMAFNLTILSLTELLSLGGLLGNGVALWLLNQNVYRNPFSIYLLDV ACADLIFLCCHMVAIIPELLQDQLNFPEFVHISLIMLRFFCYIVGLSLLVAISTEQCLAT LFPSGYLCRRPRYLTTCVCAFIWVLCLLLDLLLSGACTQFFGAPSYHLCGMLWLVVAVLL AALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVLLVILLFLFCGLPFGIFWLSKNLSWH TPLYFYHFSFFMASVHSAAKPAIYFFLGSTPGQRFQEPLRLVLQRALGDEAELGAVREAS QGGLVDMTV
Uniprot No.

Target Background

Function
Orphan receptor. May regulate nociceptor function and/or development, including the sensation or modulation of pain.
Database Links

KEGG: rno:404660

UniGene: Rn.189891

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mrgpre and how does it relate to other MRGPR family members?

Mrgpre (also known as GPR167 or MRGE) is one of the Mas-related G protein-coupled receptors with well-defined sequence homology in both mice and humans. The MRGPR family shows high structural similarity, featuring short (3-21 amino acid) N-termini and relatively conserved transmembrane and intracellular domains. The primary variations among family members occur in the extracellular regions, which confer unique ligand binding properties . Evolutionarily, Mrgpre belongs to a subset of MRGPRs (specifically Mrgprd, Mrgpre, Mrgprf, and Mrgprg) that show conserved homology across species, unlike some other family members that are species-specific .

How are rat Mrgpre receptors typically studied in comparison to human MRGPRE?

Rat Mrgpre receptors are studied using similar molecular and cellular techniques as their human counterparts, but with important species-specific considerations. Research commonly employs expression of rat Mrgpre in cell lines (similar to MRGPRX2 transfection in RBL-2H3 cells), followed by functional assays such as histamine release measurements . Due to evolutionary divergence, humanized mice or rats are frequently employed to test human MRGPRE functions . When analyzing rat Mrgpre, reverse-transcriptase polymerase chain reaction (RT-PCR) is commonly used to assess expression in relevant tissues like peritoneal cells and peritoneal mast cells, as demonstrated in studies of the related receptor MRGPRB3 .

What are the optimal expression systems for producing functional recombinant rat Mrgpre?

For recombinant rat Mrgpre expression, mammalian expression systems are strongly preferred over bacterial or insect cell systems due to the requirement for proper post-translational modifications and membrane insertion. The most effective approach utilizes expression vectors with strong promoters such as CMV, as seen in the MRGPRE-Tango system (Addgene plasmid #66436) . For optimal results, HEK293 cells or neuronally-derived cell lines like F11 (DRG neuron-derived) provide appropriate cellular machinery for proper receptor folding and trafficking . When designing expression constructs, inclusion of an N-terminal tag (such as FLAG) facilitates detection and purification while minimizing interference with ligand binding at the receptor's extracellular domains .

How can researchers verify successful expression of recombinant rat Mrgpre?

Verification of recombinant Mrgpre expression requires a multi-faceted approach:

  • Protein expression verification: Western blotting using antibodies against either Mrgpre or an incorporated epitope tag (like FLAG tag in the MRGPRE-Tango system) .

  • Membrane localization assessment: Immunofluorescence microscopy with membrane co-localization markers or surface biotinylation assays.

  • Functional validation: Measuring activation of known downstream signaling pathways, such as calcium mobilization, ERK1/2 activation, or reporter gene assays that utilize TCF/SRF or NFAT response elements .

  • mRNA verification: RT-PCR analysis using primers specific to the rat Mrgpre sequence, similar to approaches used for related receptors like rat MRGPRB3 .

What reporter gene systems are most effective for studying rat Mrgpre signaling pathways?

Based on findings with related MRGPRs, the following reporter systems are most effective for studying rat Mrgpre signaling:

Reporter SystemPathway MeasuredControls/InhibitorsApplication
TCF/SRF reporterMAPK/ERK pathwayPD-184352 (ERK1/2 inhibitor)Measures transcriptional activation via ERK signaling
NFAT reporterCalcium/calcineurin pathwayCyclosporin A (CsA)Detects calcium-dependent transcriptional activation
CREB reportercAMP pathwayPKA inhibitorsAssesses cAMP-dependent signaling
PRESTO-Tangoβ-arrestin recruitment-Measures receptor activation via arrestin translocation

The PRESTO-Tango system is particularly valuable as it provides a platform for arrestin-dependent activation, allowing parallel screening of multiple receptors and comparing their activation profiles . When conducting these assays, it's critical to include both positive controls (known GPCR activators) and pathway-specific inhibitors to confirm signaling specificity .

What functional assays best characterize the immune-related activities of rat Mrgpre?

For characterizing immune-related activities of rat Mrgpre, researchers should employ these methodological approaches:

  • Mast cell degranulation assays: Measure histamine or β-hexosaminidase release from RBL-2H3 cells transfected with rat Mrgpre or primary rat peritoneal mast cells, following receptor stimulation with potential ligands .

  • Cytokine/chemokine release measurements: Quantify the release of inflammatory mediators (e.g., CCL2) using ELISA or multiplex cytokine assays following receptor activation .

  • Calcium flux assays: Monitor intracellular calcium mobilization using fluorescent indicators like Fura-2 or Fluo-4 to assess immediate receptor activation responses.

  • Immune cell chemotaxis assays: Evaluate migration of neutrophils, eosinophils, or other immune cells in response to conditioned media from Mrgpre-activated cells .

  • In vivo inflammatory models: Assess the impact of Mrgpre activation or deletion on inflammatory responses in rat models of infection, allergy, or inflammatory disease .

How do rat Mrgpre receptors differ structurally and functionally from human MRGPRE?

Rat Mrgpre receptors exhibit notable species-specific differences compared to human MRGPRE:

  • Sequence divergence: Unlike highly conserved GPCRs (e.g., 5-HT1A receptor), MRGPRs show significant sequence variation across species. While rat and human Mrgpre maintain recognizable homology, they display substantial differences in their extracellular domains, affecting ligand specificity and binding affinity .

  • Polymorphism rates: Human MRGPRs, including MRGPRE, display unusually high polymorphism rates—approximately 50-100 times higher than other GPCRs like 5-HT receptors. These genetic variations may contribute to functional differences between species and even between individuals .

  • Signaling pathway preferences: While core signaling mechanisms are conserved, species differences in G-protein coupling efficiency and β-arrestin recruitment may exist, necessitating careful validation of results across species .

  • Expression patterns: Tissue-specific expression profiles may differ between rat and human Mrgpre, particularly in specialized immune and neuronal populations .

What strategies help overcome the challenges of translating rat Mrgpre findings to human applications?

To address translational challenges between rat and human MRGPRE research:

  • Parallel testing in both species: Conduct comparative experiments with both rat Mrgpre and human MRGPRE under identical conditions to identify conserved and divergent properties.

  • Humanized rat models: Generate transgenic rats expressing human MRGPRE to better model human receptor pharmacology in vivo.

  • Domain swapping experiments: Create chimeric receptors containing domains from both species to identify critical regions responsible for functional differences.

  • Comparative ligand screening: Screen compound libraries against both species' receptors to identify ligands with conserved activity or species selectivity.

  • Bioinformatic prediction: Use structural modeling and sequence analysis to predict functional consequences of species differences, guiding experimental design .

How do recombinant rat Mrgpre receptors couple to downstream signaling pathways?

Recombinant rat Mrgpre receptors engage multiple signaling cascades upon activation, similar to other MRGPR family members:

  • ERK1/2 MAPK pathway: Activation leads to phosphorylation of ERK1/2, resulting in TCF/SRF-dependent gene expression, including early growth response protein-1 (EGR1). This pathway is inhibitable by specific ERK1/2 inhibitors like PD-184352 .

  • Calcium/calcineurin pathway: Receptor activation triggers intracellular calcium mobilization, activating calcineurin and subsequent NFAT nuclear translocation. This pathway is sensitive to calcineurin inhibitors like cyclosporin A (CsA) .

  • G-protein mediated signaling: Depending on the specific G-protein coupling (Gq/11, Gi/o, or G12/13), different second messenger systems can be activated, leading to diverse cellular responses.

  • β-arrestin recruitment: Following activation, β-arrestin recruitment can lead to receptor internalization and potentially arrestin-dependent signaling, as exploited in the PRESTO-Tango assay system .

Understanding the relative contribution of each pathway requires selective pathway inhibitors and genetic manipulation approaches.

What molecular factors influence ligand specificity and binding affinity to rat Mrgpre?

The molecular determinants of ligand specificity for rat Mrgpre include:

  • Extracellular domain variability: The greatest sequence variation among MRGPR family members resides in the extracellular domains, which imparts unique ligand binding potential. For rat Mrgpre, these regions likely define its distinct pharmacological profile .

  • Charged residue distribution: Positively charged ligands (like certain neuropeptides and antimicrobial peptides) often interact with negatively charged residues in the extracellular loops and transmembrane domains of MRGPRs .

  • N-terminal length: Mrgpre possesses a relatively short N-terminus (3-21 amino acids), which influences its interaction with larger protein ligands and peptides .

  • Transmembrane binding pocket: The configuration of the binding pocket within the transmembrane helices determines specificity for small molecule ligands, as observed with drug interactions at the related receptor MRGPRX2/Mrgprb2 .

  • Post-translational modifications: Glycosylation patterns on the extracellular domains may affect ligand recognition and binding kinetics.

What evidence links rat Mrgpre to inflammatory and immune responses?

While direct evidence for rat Mrgpre in immune responses is still emerging, research on related MRGPR family members provides important insights:

  • Mast cell activation: Related MRGPRs trigger mast cell degranulation in response to neuropeptides, antimicrobial peptides, and certain drugs, suggesting potential similar functions for Mrgpre .

  • Neuroinflammatory crosstalk: MRGPRs facilitate communication between sensory nerves and immune cells, with neuropeptides activating these receptors on immune cells to drive recruitment and activation during inflammation .

  • Bacterial defense mechanisms: The MRGPR-mast cell axis helps control bacterial infections at barrier surfaces, coordinating the recruitment of neutrophils and other immune effectors .

  • Chemokine production: Activation of certain MRGPRs (like MRGPR-X1) induces the release of chemokines such as CCL2, potentially enhancing inflammatory responses through recruitment of CCR2-expressing cells .

  • Expression pattern: The presence of MRGPRs on various immune cell types, including mast cells, dendritic cells, and neutrophils, underscores their capacity to regulate diverse immune responses .

How might targeting rat Mrgpre therapeutically affect pain pathways and immune modulation?

Therapeutic targeting of rat Mrgpre could have significant implications for both pain and immune modulation:

  • Pain pathway modulation: Related MRGPRs like MRGPR-X1 are implicated in both acute pain induction and chronic pain development through expression of factors like EGR1 and CCR2 .

  • Inflammatory disease intervention: By modulating the activation of immune cells, Mrgpre targeting could potentially influence inflammatory conditions at barrier surfaces like skin and mucosa .

  • Reducing adverse drug reactions: Understanding Mrgpre pharmacology may help develop strategies to minimize pseudo-allergic reactions like those mediated by MRGPRX2/Mrgprb2 in response to certain antibiotics and opioids .

  • Neuropathic pain treatment: If rat Mrgpre functions similarly to MRGPR-X1 in regulating CCR2 expression and chemokine signaling, targeting this pathway could represent a novel approach to alleviating chemokine-promoted neuropathic pain .

  • Antimicrobial defense enhancement: Potentially leveraging the role of MRGPRs in bacterial defense at barrier surfaces to boost immune responses to infections .

What are common technical challenges when working with recombinant rat Mrgpre and how can they be overcome?

Researchers commonly encounter these challenges with recombinant rat Mrgpre:

  • Low surface expression:

    • Problem: Poor trafficking to cell membrane

    • Solution: Optimize signal peptide sequences, use specialized mammalian expression vectors like pcDNA3.1(+), incorporate trafficking-enhancing sequences, or use cell lines with neuronal or mast cell background for better processing .

  • Constitutive activity:

    • Problem: High baseline signaling masking ligand-induced effects

    • Solution: Use inducible expression systems, employ inverse agonists to reduce baseline, normalize data to account for basal activity.

  • Ligand identification difficulties:

    • Problem: Unknown or poorly characterized endogenous ligands

    • Solution: Perform unbiased screening with peptide libraries, test related MRGPR ligands across species, use the PRESTO-Tango system for parallel screening of potential activators .

  • Species-specific pharmacology:

    • Problem: Discrepancies between rat and human receptor responses

    • Solution: Always include human MRGPRE controls, create chimeric receptors to identify critical domains for species differences .

  • Antibody specificity issues:

    • Problem: Limited availability of specific anti-Mrgpre antibodies

    • Solution: Use epitope tagging strategies (like the FLAG tag in MRGPRE-Tango) for reliable detection .

How can researchers design experiments to distinguish Mrgpre-specific effects from other MRGPR family members in complex systems?

To achieve specificity in Mrgpre research:

  • Selective knockdown/knockout approaches: Use siRNA or CRISPR-Cas9 to specifically target Mrgpre while confirming continued expression of other MRGPRs. For in vivo studies, compare Mrgpre-specific knockout rats with wild-type controls and broader MRGPR family knockouts.

  • Pharmacological selectivity profiles: Develop an experimental matrix using multiple ligands with differential selectivity across MRGPR family members, creating a pharmacological fingerprint to identify receptor-specific responses.

  • Expression correlation analysis: In mixed cell populations, correlate observed responses with quantified Mrgpre expression levels (by qPCR) across different samples or conditions.

  • Cell type-specific approaches: Isolate specific cell populations (e.g., mast cells from MC-deficient rats vs. wild-type rats) to compare Mrgpre-dependent responses, as demonstrated with MRGPRB3 studies .

  • Competitive antagonism strategies: Use subtype-selective antagonists (when available) to block specific receptor contributions in systems expressing multiple MRGPRs.

  • Heterologous expression comparisons: Express rat Mrgpre alone or in combination with other MRGPR family members in null backgrounds to assess potential receptor interactions and distinguish individual contributions.

What emerging technologies show promise for advancing rat Mrgpre research?

Cutting-edge approaches poised to revolutionize Mrgpre research include:

  • Cryo-EM structural studies: Determination of rat Mrgpre structure in various activation states would provide unprecedented insights into ligand binding mechanisms and conformational changes.

  • CRISPR-based screening: Genome-wide CRISPR screens in Mrgpre-expressing systems could identify novel components of signaling pathways and regulatory mechanisms.

  • Single-cell transcriptomics: Analysis of Mrgpre expression at single-cell resolution across tissues would reveal previously undetected cellular populations and context-dependent regulation.

  • Optogenetic and chemogenetic tools: Development of light-activated or designer drug-activated Mrgpre variants would enable precise temporal control of receptor activation in vivo.

  • Biosensor development: Creation of conformational biosensors to directly measure Mrgpre activation states in living cells would allow real-time monitoring of receptor dynamics.

  • AI-driven ligand discovery: Application of machine learning approaches to predict novel Mrgpre ligands based on structural models and existing pharmacological data.

How can integrative approaches help resolve contradictory findings in the MRGPR field?

To address contradictions in MRGPR research:

  • Standardized experimental frameworks: Establish common methodological platforms for receptor characterization across laboratories, including standardized cell lines, assay conditions, and data normalization approaches.

  • Cross-species comparative studies: Systematically compare rat, mouse, and human MRGPR orthologs under identical conditions to distinguish species-specific from conserved properties .

  • Multi-omics integration: Combine proteomics, transcriptomics, and functional genomics data to build comprehensive models of MRGPR signaling networks across contexts.

  • Systematic review of polymorphism effects: Given the high rate of polymorphisms in MRGPRs (50-100 times higher than other GPCRs), systematically evaluate how specific variants affect receptor function .

  • Context-dependent signaling analysis: Investigate how cellular context (e.g., mast cells vs. neurons) affects signaling outcomes for the same receptor, potentially explaining contradictory findings from different experimental systems.

  • Collaborative consortium approaches: Establish MRGPR research consortia to coordinate efforts, share resources, and systematically address key questions using complementary expertise and methodologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.