Recombinant Rat Mas-related G-protein coupled receptor member G (Mrgprg)

Shipped with Ice Packs
In Stock

Description

Research Tools and Applications

Recombinant Mrgprg facilitates functional and pharmacological studies:

Available Reagents (Rat Mrgprg)

Product CodeSourceApplications
CSB-CF749248RAE. coliLigand binding, signaling assays
CSB-YP749248RA1YeastStructural studies
CSB-EP749248RA1E. coliAntibody development, ELISA

Data sourced from CUSABIO .

Key Findings

  • Role in pain modulation: MRGPRs like MrgprC11 regulate nociceptive sensitization via Gi/Gq signaling . While direct evidence for Mrgprg is limited, its structural similarity suggests analogous roles in pain or itch pathways .

  • Mast cell activation: Human MRGPRX2 (a homolog) triggers IgE-independent degranulation via Gi/Gq synergy . Rat Mrgprg may share functional overlap, though ligand specificity differs .

Challenges and Opportunities

  • Ligand discovery: High-throughput screening using recombinant Mrgprg could identify agonists/antagonists, as seen with MRGPRX1–X4 .

  • Structural insights: No high-resolution structures exist for Mrgprg, but cryo-EM studies of MRGPRD and MRGPRX2 reveal shallow extracellular ligand pockets and TM6 conformational changes during activation .

  • Species specificity: MRGPR sequences vary significantly across mammals, complicating translational research .

Future Directions

  • Therapeutic targeting: MRGPRs are emerging targets for chronic pain and inflammatory diseases. Recombinant Mrgprg could validate its role in these pathways .

  • Polymorphism studies: Human MRGPRs exhibit genetic variations affecting drug responses . Rat models with recombinant Mrgprg may elucidate functional impacts of mutations.

Recombinant Rat Mrgprg remains a critical tool for deorphanizing this receptor and clarifying its physiological roles. Despite limited direct data, its homology to better-studied MRGPRs positions it as a promising target for sensory and immune modulation research.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
Mrgprg; Mrgg; Mas-related G-protein coupled receptor member G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MLSIFNIWGTFNRVLFFLSLTVSLAGLAGNTLLLWHLGLRIKKGPFNTYLLHLAAADFLF LSCQVGFSIAKIASGYEDTLYFPVTFLWFAVGLWLLAAFIVDCCLSYMFPSFCGPNCRPR YTSFVLCLVIWALTMLAVLLPANACGLLYNRMSLLVCLKYHWVSVVWLGVLASTACGASM FLLVFGNCCSSQPPSKFCKLAQCSGILLFFCRLPLVFYWCLRPVIKFLLPFFFPLATLLA CIDSSAKPLLYYLKGRQLRKEPLQVALNRALGEESQSSSGGISLPMSRV
Uniprot No.

Target Background

Function
Orphan receptor. May regulate nociceptor function and/or development, including the sensation or modulation of pain.
Database Links

KEGG: rno:309133

UniGene: Rn.112764

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mrgprg and what is its classification in the GPCR family?

Mrgprg (also known as GPR169 or MRGG) belongs to the Class A (Rhodopsin) orphan receptor subfamily of G protein-coupled receptors (GPCRs). It is part of the larger Mas-related G protein-coupled receptor (MRGPR) family, which comprises almost 40 members grouped into nine distinct subfamilies (MRGPRA to -H and -X) . Mrgprg is considered an "orphan" receptor because its endogenous ligand has not been definitively identified . Like other GPCRs, it features a characteristic seven-transmembrane domain structure with an extracellular N-terminus and intracellular C-terminus .

How does rat Mrgprg differ from human MRGPRG and other orthologs?

While the search results don't provide specific sequence comparisons between rat and human Mrgprg, significant species variations exist within the MRGPR family that researchers should consider:

  • Sequence and structural differences: Human MRGPRG contains 289 amino acids with specific transmembrane domain arrangements as detailed in the protein database .

  • Functional divergence: Cross-species variations in MRGPR agonist activity and receptor function are documented, making it essential to characterize species-specific pharmacological properties .

  • Expression patterns: While many MRGPRs are nearly exclusively expressed in specific dorsal root and trigeminal ganglia neurons across species, the exact expression profile may vary between rats and humans .

Researchers should be cautious when extrapolating findings between species due to these potential differences, particularly when developing therapeutic interventions.

What expression systems are most effective for recombinant rat Mrgprg production?

Based on general approaches for GPCR expression, the following systems are recommended for recombinant rat Mrgprg:

  • Mammalian cell lines: HEK293 and CHO cells are preferred for functional studies as they provide appropriate post-translational modifications and membrane trafficking machinery.

  • Insect cell systems: Sf9 or High Five cells using baculovirus expression vectors can yield higher protein amounts for structural studies.

  • Expression constructs: Including epitope tags (His, FLAG) facilitates detection and purification while properly designed signal sequences ensures appropriate membrane localization.

  • Inducible expression systems: Tetracycline-inducible systems allow controlled expression levels, which is crucial since overexpression of MRGPRs has been shown to potentially lead to tumorigenic and proliferative actions in vitro when exceeding physiological thresholds .

When selecting an expression system, researchers should consider the downstream applications and whether functional activity or protein yield is the priority.

What are the challenges in identifying endogenous ligands for orphan receptors like rat Mrgprg?

Deorphanizing GPCRs like Mrgprg presents several methodological challenges:

  • Screening limitations: Traditional ligand screening approaches may miss compounds with low affinity or those requiring specific cellular contexts for activity.

  • Species differences: Potential ligands for rat Mrgprg may differ from those of human MRGPRG, complicating cross-species comparisons .

  • Temporal and spatial expression: The endogenous ligand may be produced only under specific physiological conditions or in restricted tissue microenvironments.

  • Methodological approaches: Researchers studying related MRGPRs have evaluated various compounds as potential ligands, including β-alanine, angiotensin-(1-7), alamandine, GABA, cortistatin-14, and cleavage products of proenkephalin, pro-opiomelanocortin, prodynorphin, or pro-neuropeptide-FF-A .

  • Functional considerations: Some MRGPRs may function primarily through constitutive activity rather than ligand-dependent activation.

Successful deorphanization typically requires integration of multiple complementary approaches including tissue extract screening, bioinformatic prediction, and careful functional validation.

How can BAC transgenic approaches be optimized for studying rat Mrgprg function?

Bacterial Artificial Chromosome (BAC) transgenic approaches offer advantages for studying Mrgprg function, as demonstrated in research with related Mrgpr receptors:

  • Promoter considerations: Using the native Mrgprg promoter maintains physiological expression patterns, while cell-type specific promoters can restrict expression to particular neuronal populations of interest .

  • Reporter integration: Incorporating fluorescent reporters like GFP-Cre fusion proteins enables identification of Mrgprg-expressing cells for electrophysiological recordings and histological analyses .

  • Genetic background: BAC transgenic lines should be developed on appropriate genetic backgrounds, potentially including Mrgpr-cluster knockout mice to eliminate confounding effects from endogenous receptors .

  • Validation requirements: Comprehensive validation through:

    • In situ hybridization to confirm appropriate expression patterns

    • Functional assays to verify receptor activity

    • Behavioral testing to assess physiological relevance

  • Cross-breeding strategies: Mating with other transgenic lines can enhance experimental power, as demonstrated in studies where MrgprC11 transgenic lines were mated with MrgprA3 transgenic lines to study overlapping neuronal populations .

When designing BAC transgenic approaches, researchers should carefully consider the size of genomic fragments to include sufficient regulatory elements while maintaining construct stability.

What functional assays best characterize rat Mrgprg signaling pathways?

Since Mrgprg is an orphan receptor, functional characterization requires creative approaches:

  • G-protein coupling assays:

    • GTPγS binding assays to determine G-protein activation

    • Second messenger assays to measure downstream effectors (Ca²⁺ mobilization, cAMP production)

    • BRET/FRET-based interaction studies to monitor receptor-G protein association

  • Neuronal activation studies:

    • Calcium imaging in Mrgprg-expressing sensory neurons

    • Electrophysiological recordings to assess changes in neuronal excitability

    • Analysis of pain-related behavior following potential ligand administration, similar to methods used for related MRGPRs

  • Signaling pathway analysis:

    • Phosphoprotein profiling to identify activated downstream kinases

    • Internalization assays to assess receptor trafficking

    • Bias analysis to quantify pathway preferences

  • Comparative approaches:

    • Evaluating responses to compounds known to activate related MRGPRs

    • Cross-species comparisons to identify conserved signaling mechanisms

    • Testing BAM8-22 peptide, which activates several Mrgpr family members

These assays should be conducted in both heterologous expression systems and native neuronal contexts to ensure physiological relevance.

What is known about the role of rat Mrgprg in nociception and pain processing?

While specific data on rat Mrgprg's role in pain is limited, inferences can be made from research on related MRGPRs:

  • Expression patterns: Most MRGPRs, including those in the MRGPRD subfamily, are nearly exclusively expressed in specific dorsal root and trigeminal ganglia neurons, suggesting roles in nociception, itch/pruritus, and thermosensation .

  • Functional evidence: Studies with related Mrgpr members have demonstrated:

    • MRGPRC activation by agonists via intrathecal application attenuates inflammatory and neuropathic pain-related behavior in rodent models

    • Mrgpr-cluster knockout mice show enhanced inflammatory pain and prolonged neuropathic pain

    • Certain Mrgprs at central terminals of primary sensory neurons may function as endogenous pain inhibitor mechanisms

  • Potential mechanisms:

    • Modulation of ion channel activity in sensory neurons

    • Regulation of neurotransmitter release at central terminals

    • Influence on neuronal excitability through second messenger systems

  • Pharmacological significance: Understanding Mrgprg's role could identify novel pain management targets, as demonstrated by the effects of compounds like BAM8-22 and ML382 in alleviating evoked pain hypersensitivity in animal models .

Further research using genetic models and selective pharmacological tools is needed to clarify the specific role of rat Mrgprg in pain processing.

How does heterologous expression affect rat Mrgprg pharmacology and function?

Heterologous expression systems present both opportunities and challenges for Mrgprg research:

  • Expression level effects:

    • Overexpression may lead to constitutive activity not seen at physiological levels

    • MRGPRs have been shown to present tumorigenic and proliferative actions when expression exceeds physiological thresholds in vitro

    • Receptors may form non-native homo- or heterodimers at high densities

  • Host cell considerations:

    • Lipid composition affects membrane dynamics and receptor function

    • Co-expression of relevant G-proteins is necessary for proper signaling

    • Species-specific post-translational modifications may alter receptor properties

  • Functional validation approaches:

    • Comparisons with native sensory neuron responses where possible

    • Use of multiple independent cell lines to confirm findings

    • Correlation between in vitro pharmacology and in vivo effects

  • Technical solutions:

    • Inducible expression systems to control receptor levels

    • Co-expression of relevant signaling partners

    • Development of cell lines derived from sensory neurons

Understanding these factors is crucial for accurate interpretation of pharmacological data and translation to physiological contexts.

What are the implications of species differences in Mrgprg for translational research?

Species variations present significant challenges for translational applications:

  • Pharmacological divergence:

    • Cross-species variation in MRGPR agonist activity and receptor function has been documented

    • The functional properties of human MRGPRs cannot be fully inferred from rodent orthologs

    • Compounds effective in rodent models may have different efficacy in humans

  • Experimental design considerations:

    • Generation of humanized mouse models expressing human MRGPRX1 under rodent promoters provides a valuable translational approach

    • BAC transgenic strategies can restrict expression of human receptors to appropriate neuronal subsets

    • Parallel testing in multiple species is advisable during drug development

  • Structural approaches:

    • Comparative analysis of binding pockets between species can identify conserved regions for drug targeting

    • Focus on evolutionarily conserved signaling mechanisms may improve translational success

  • Clinical relevance:

    • Expression pattern differences between species may result in unexpected side effects

    • Species-specific receptor regulation could affect therapeutic efficacy

Successful translational research requires understanding both the conserved features and species-specific differences in Mrgprg biology.

How can investigators study potential Mrgprg heterodimers with other GPCRs?

Investigation of receptor interactions requires specialized approaches:

  • Physical interaction methods:

    • FRET/BRET proximity assays between differentially tagged receptors

    • Co-immunoprecipitation studies

    • Protein complementation assays (split luciferase, BiFC)

    • Cross-linking followed by mass spectrometry

  • Functional interaction studies:

    • Altered pharmacology in co-expression systems

    • Modified signaling pathway activation patterns

    • Changes in receptor trafficking and internalization

    • Altered ligand binding properties

  • Advanced imaging approaches:

    • Single-molecule tracking to analyze receptor dynamics

    • Super-resolution microscopy to visualize receptor clusters

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility analysis

  • Physiological relevance:

    • Co-expression analysis in native tissues

    • Electrophysiological assessment of functional interactions

    • In vivo validation of interactions identified in vitro

These approaches are particularly relevant as evidence suggests MRGPRE most likely binds to related receptor MRGPRD to form heterodimers, indicating similar interactions might occur with Mrgprg .

What approaches can identify the neural circuits in which rat Mrgprg functions?

Neural circuit mapping for Mrgprg requires integration of molecular, anatomical, and functional techniques:

  • Genetic approaches:

    • BAC transgenic mice expressing Cre recombinase under Mrgprg promoter control

    • Conditional expression of optogenetic or chemogenetic tools in Mrgprg-expressing neurons

    • Activity-dependent labeling using TRAP (Targeted Recombination in Active Populations) methodology

  • Anatomical methods:

    • Anterograde and retrograde tracing from Mrgprg-expressing neurons

    • Trans-synaptic viral tracing to identify connected neurons

    • Tissue clearing combined with 3D imaging for complete circuit visualization

  • Functional characterization:

    • In vivo calcium imaging during sensory stimulation

    • Electrophysiological recordings in identified circuits

    • Behavioral testing following selective activation or inhibition of Mrgprg neurons

  • Pain models integration:

    • Analysis of circuit changes in inflammatory pain models (CFA injection)

    • Evaluation in neuropathic pain models (chronic constriction injury)

    • Assessment of central sensitization mechanisms

These approaches can reveal how Mrgprg-expressing neurons integrate into wider pain processing networks and identify potential intervention points for analgesia development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.