Recombinant Rat Mas-related G-protein coupled receptor member H (Mrgprh)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Recombinant rat Mrgprh is primarily produced using mammalian expression systems, with HEK293 cells being the most frequently employed host . This choice of expression system is critical for proper folding and post-translational modifications of the receptor, which are essential for maintaining its native structure and functionality. The table below summarizes the common expression systems used for rat Mrgprh production:

Expression SystemAdvantagesProduct FormsReferences
HEK293 cellsNative-like folding, appropriate post-translational modificationsSoluble protein, pre-coupled beads
Mammalian cells (general)High protein quality, proper membrane protein processingFull-length or partial length proteins

Protein Tags and Purification Strategies

Various protein tags are employed to facilitate the purification and application of recombinant rat Mrgprh:

  • His-tag: Commonly used for affinity purification via immobilized metal affinity chromatography (IMAC)

  • Fc-tag: Enhances protein stability and facilitates purification using Protein A/G resins

  • Avi-tag: Enables site-specific biotinylation for detection and immobilization applications

  • Combination tags: His-Fc-Avi tagged versions provide multiple functionalities

Purification typically involves affinity chromatography methods, with reported purities ranging from >80% to ≥90% as determined by SDS-PAGE and Western blot analysis .

Quality Parameters and Physical Properties

Commercial preparations of recombinant rat Mrgprh undergo rigorous quality control to ensure consistency and reliability for research applications. Key quality parameters include:

Purity and Endotoxin Levels

ParameterTypical SpecificationAnalytical MethodReferences
Purity>80% to ≥90%SDS-PAGE, Western Blot
Endotoxin<1.0 EU per μg proteinLAL (Limulus Amebocyte Lysate) method

Available Product Formats

Recombinant rat Mrgprh is commercially available in several formats designed for specific research applications:

FormatTypical QuantityPotential ApplicationsReferences
Soluble protein (His-tagged)Custom amountsStructural studies, antibody generation
His-Fc-Avi-tagged proteinCustom amountsEnhanced stability, versatile detection
Pre-coupled magnetic beads10 mg beads/mLImmunoassays, protein-protein interaction studies
ELISA kit components50 μgDetection and quantification applications

Research Applications

While specific published research using recombinant rat Mrgprh is limited, this protein serves as a valuable tool for various potential applications:

  1. Structural and Functional Studies

    • Investigation of receptor structure-function relationships

    • Analysis of ligand binding properties

    • Studies of receptor activation mechanisms

  2. Development of Research Tools

    • Generation of specific antibodies against rat Mrgprh

    • Development of screening assays for ligand discovery

    • Creation of detection methods for the native receptor

  3. Comparative Biology

    • Investigation of species differences in MRGPR family receptors

    • Evolutionary studies of sensory receptors

    • Comparative pharmacology across rodent models

  4. Specialized Applications

    • Immunoprecipitation/co-precipitation experiments

    • Cell sorting and in vitro diagnostic applications

    • Protein-protein interaction studies

MRGPR Family in Rat

The rat genome contains a defined set of MRGPR genes, including one each of the MrgprA, MrgprC, MrgprD, MrgprE, MrgprF, and MrgprH genes, and six MrgprB genes . This organization differs from both mice and humans, highlighting the species-specific evolution of this receptor family .

Potential Physiological Roles

While the specific functions of rat Mrgprh remain largely uncharacterized, insights from other MRGPR family members suggest potential roles in:

  1. Sensory Perception: Many MRGPRs, particularly MrgprD, are involved in nociception (pain sensing) and pruriception (itch sensing) . MrgprD recognizes β-alanine as a ligand and influences the excitability of polymodal nonpeptidergic nociceptors to mechanical and thermal stimuli .

  2. Immune Function: Some MRGPR family members, such as Mrgprb2 in mice and MRGPRX2 in humans, are expressed in mast cells and mediate degranulation in response to various stimuli . This suggests potential roles in inflammatory and immune responses.

  3. Signaling Pathways: MRGPRs couple to various G-protein subtypes, with many members signaling through Gi and Gq pathways . These diverse G-protein coupling preferences lead to various downstream signaling events, including modulation of intracellular calcium levels, regulation of cAMP production, and activation of kinase cascades .

Comparative Analysis with Related Receptors

Understanding rat Mrgprh in the context of related receptors provides valuable insights into its potential functions and applications:

FeatureRat MrgprhRat MrgprDMouse MrgprhHuman MRGPR Counterpart
Amino Acids321 319 321 Not directly established
Known LigandsNot establishedβ-alanine Not establishedNot applicable
Expression PatternNot well characterizedDorsal root ganglia neurons Not well characterizedNot applicable
G-protein CouplingNot establishedGi, Gq Not establishedNot applicable
Physiological RoleNot establishedPain and itch signaling Not establishedNot applicable

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Mrgprh; Mrgh; Mas-related G-protein coupled receptor member H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mrgprh
Target Protein Sequence
MEPLATTLCPQECTQTTRNETPNETTWSSEHVTKYTYISISLVICSLGLVGNGLLIWFLI FCIKRKPFTIYILHLAFADFMVLLCSSIIQLVNTFHIYDSTLVSYAVLFMIFGYNTGLHL LTAISVERCLSVLYPIWYHCRRPKHQSTVACTLLWALSVLVSGLENFFCILEVKPQFPEC RYVYIFSCTLTFLVFVPLMVFSNLILFIQVCCNLKPRQPAKLYVIIMATVILFLVFAMPM KVLLIIGYYSNSTDASVWKSLPYLNMLSTINCSINPIVYFVVGSLRRKRSRKSLKEALQK VFEEKPVVASRENEVQFSLPL
Uniprot No.

Target Background

Function
Orphan receptor. May regulate nociceptor function and/or development, including the sensation or modulation of pain.
Database Links
Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Mrgpr family and how does Mrgprh fit within this classification?

The Mrgpr family comprises G protein-coupled receptors first identified in sensory neurons, with high homology (approximately 35%) to the MAS1 proto-oncogene. Based on sequence similarities, Mrgprs are clustered into subfamilies Mrgpra, Mrgprb, and Mrgprc. In mice, this family contains 50 members, though only 22 have intact open reading frames. The remaining are pseudogenes. Additionally, well-defined Mrgprs with sequence homology in both mice and humans include Mrgprd, Mrgpre, Mrgprf, and Mrgprg. In total, 26 murine and 8 human MRGPRs with intact coding sequences constitute this receptor family .

Mrgprh belongs to this extended family, with expression patterns and functions that share characteristics with other family members while maintaining distinct properties relevant to sensory neuron function and immune regulation.

What are the characteristic structural features of Mrgprh?

Like other members of the Mrgpr family, Mrgprh likely exhibits the characteristic structural features including:

  • Short N-terminus (typically 3-21 amino acids)

  • Relatively conserved transmembrane and intracellular domains

  • Highest variability in extracellular regions, which confers unique ligand binding properties

  • Seven-transmembrane domain structure typical of G protein-coupled receptors

These structural characteristics allow Mrgprh to interact with specific ligands and couple to distinct intracellular signaling pathways that mediate its biological functions.

What is currently known about the expression pattern of Mrgprh?

While the search results don't specifically detail Mrgprh expression, the expression patterns of other Mrgpr family members suggest that Mrgprh likely follows similar tissue-specific distribution. Many Mrgprs are exclusively expressed in distinct subsets of small-diameter dorsal root ganglia (DRG) neurons, which are primary sensory neurons involved in nociception . Some Mrgprs, like MrgprX2 in humans and MrgprB2 in mice, are exclusively expressed in mast cells, a type of innate immune cell . Research exploring the specific expression profile of Mrgprh in rat tissues would provide valuable insights into its potential physiological roles.

What signaling pathways are associated with Mrgprh activation?

Based on what is known about other Mrgpr family members, Mrgprh likely couples to specific G proteins to initiate downstream signaling cascades. Different Mrgprs couple to different G protein subunits:

  • Some Mrgprs like MrgprA3 show evidence of coupling to Gβγ in some experimental systems, while other studies suggest coupling to alternative G proteins

  • MrgprD has been shown to couple to Gαs and PKA in DRG sensory neurons

  • The coupling may be context-dependent, showing different patterns in cell bodies versus nerve terminals

Researchers investigating Mrgprh should consider examining multiple potential coupling mechanisms, including calcium mobilization, cAMP production, and interactions with TRP channels that are common downstream effectors for several Mrgpr family members .

How do Mrgprs contribute to pain modulation, and what might be Mrgprh's specific role?

Several Mrgpr family members play significant roles in pain modulation:

  • Deletion of a chromosomal locus spanning 12 Mrgpr genes in mice leads to prolonged mechanical and thermal pain hypersensitivity after inflammation

  • Some Mrgprs may constitute endogenous inhibitors of pathological pain

  • MrgprC11 activation by bovine adrenal medulla peptide 8-22 (BAM 8-22) shows analgesic effects on both inflammatory heat hyperalgesia and neuropathic mechanical allodynia

  • MrgprX1 in humans can induce acute pain but also affects factors involved in chronic pain development

Researchers should investigate whether Mrgprh functions similarly to other family members in pain modulation or if it has distinct roles. Experiments comparing wild-type and Mrgprh-knockout models in various pain paradigms would be valuable to elucidate its specific contribution.

How does Mrgprh potentially interact with TRP channels in sensory neurons?

Several Mrgpr family members functionally interact with TRP channels:

  • MrgprA3 has been suggested to couple to TRPA1, though evidence remains controversial

  • MrgprD has been shown to couple to TRPA1 in DRG sensory neurons

  • Activation of these pathways can influence neuronal excitability and sensory transmission

For researchers studying Mrgprh, it would be important to investigate potential functional coupling to TRP channels using techniques such as calcium imaging in the presence of specific TRP channel blockers, electrophysiological recordings, and co-immunoprecipitation studies to detect physical interactions.

What are the optimal expression systems for producing recombinant rat Mrgprh?

When expressing recombinant rat Mrgprh, researchers should consider:

  • Mammalian expression systems (HEK293, CHO cells) that provide appropriate post-translational modifications

  • Neuronal cell lines (like F11 cells derived from DRG neurons) that may contain necessary cofactors for proper receptor function

  • Inclusion of epitope tags (e.g., FLAG, HA, or His tags) for detection and purification while ensuring these modifications don't interfere with receptor function

Specific promoters driving high expression in neuronal cells (like the NSE promoter) may be advantageous for some applications. Quality control should include verification of surface expression using immunofluorescence or cell-surface biotinylation assays.

What are effective approaches for identifying and validating ligands for recombinant rat Mrgprh?

Ligand identification for orphan receptors like Mrgprh can employ several complementary approaches:

  • Candidate-based approaches testing compounds known to activate related Mrgprs:

    • Neuropeptides such as BAM 8-22, which activates MrgprC11

    • Small molecule drugs that are known to activate other Mrgprs

    • Endogenous compounds from tissues where Mrgprh is expressed

  • Unbiased screening approaches:

    • High-throughput calcium imaging or FLIPR assays

    • Beta-arrestin recruitment assays

    • GTPγS binding assays to detect G protein coupling

  • Validation should include:

    • Dose-response relationships

    • Specificity testing against other GPCRs

    • Testing in both heterologous systems and native cells expressing Mrgprh

What electrophysiological protocols are most suitable for characterizing Mrgprh function in sensory neurons?

Based on approaches used for other Mrgpr family members, effective electrophysiological approaches would include:

  • Patch-clamp recordings from DRG neurons expressing Mrgprh to measure:

    • Changes in resting membrane potential

    • Action potential firing frequency

    • Specific ionic currents (e.g., calcium, sodium, potassium)

  • Ex vivo DRG nerve-skin preparation recordings:

    • Extracellular recordings from cell bodies while applying potential ligands to the skin

    • This approach better preserves native neuronal circuitry

  • Dorsal horn wide dynamic-range (WDR) neuron recordings:

    • To assess windup response, an electrophysiological model for central pain sensitization

    • This has been successfully used to demonstrate Mrgpr involvement in pain modulation

How can researchers develop transgenic models to study Mrgprh function in vivo?

Creating transgenic models to study Mrgprh function could include:

  • Knockout strategies:

    • CRISPR/Cas9-mediated deletion of Mrgprh

    • Conditional knockout using Cre-loxP system with DRG-specific promoters

  • Reporter lines:

    • Knock-in of fluorescent reporters (GFP, tdTomato) to visualize Mrgprh-expressing cells

    • Similar to the approach used in identifying MrgprA3-expressing neurons

  • Humanized models:

    • Replacing rat Mrgprh with human MRGPR counterparts to facilitate translational research

    • This approach has been successful with other Mrgprs, such as replacing mouse Mrgprs with human MRGPRX1

  • In vivo imaging models:

    • Development of Mrgprh-specific calcium indicator models (similar to Pirt-GCaMP mice)

    • These would allow for real-time visualization of Mrgprh-expressing neuron activity

What role might Mrgprh play in neuro-immune interactions?

Given that some Mrgpr family members are expressed in both sensory neurons and immune cells, investigating Mrgprh's potential role in neuro-immune interactions should include:

  • Co-culture systems:

    • Establishing co-cultures of DRG neurons with mast cells, macrophages, or other immune cells

    • Assessing how activation of Mrgprh affects communication between these cell types

  • Chemokine signaling:

    • Investigating whether Mrgprh activation influences chemokine production and signaling

    • Similar to MRGPRX1's role in upregulating CCR2 and promoting CCL2 release

  • Inflammatory models:

    • Examining how Mrgprh expression changes during inflammatory conditions

    • Determining if Mrgprh contributes to inflammatory pain or has protective effects

This research direction is particularly promising given the demonstrated role of other Mrgprs in both pain modulation and immune cell function.

How does Mrgprh potentially contribute to chronic pain states and what therapeutic implications might this have?

Investigating Mrgprh's role in chronic pain could focus on:

  • Comparative analysis with other Mrgprs known to influence chronic pain:

    • Some Mrgprs appear to inhibit pathological pain

    • Others influence expression of markers associated with pain chronification

  • Gene expression studies:

    • Examining how Mrgprh activation affects transcription factors like SRF or NFAT

    • These factors control expression of various markers of chronic pain

  • Therapeutic development:

    • Screening for selective Mrgprh agonists or positive allosteric modulators

    • Evaluating their efficacy in chronic pain models

    • Assessing potential side effects given the restricted expression pattern

The selective expression of Mrgprs in specific neuronal populations makes them promising targets for pain therapeutics with potentially reduced side effects compared to current treatments .

What are common challenges in working with recombinant GPCRs like Mrgprh and how can they be addressed?

Common challenges and solutions include:

ChallengeSolution Approach
Low surface expressionOptimize codon usage for rat expression systems; use chaperon-enhancing additives; test multiple signal peptides
Receptor internalizationUse β-arrestin recruitment assays; develop internalization-resistant mutants for sustained signaling studies
Constitutive activityDevelop experimental controls with inverse agonists; compare with known constitutively active GPCR mutants
Promiscuous G protein couplingEmploy BRET/FRET assays to identify all G protein interactions; use specific G protein inhibitors in functional assays
Ligand identification for orphan receptorsPerform unbiased screening of tissue extracts; test compounds activating related family members

How can researchers optimize antibody-based detection methods for Mrgprh?

Given the challenges of developing specific antibodies for GPCRs:

  • Epitope selection:

    • Target unique N-terminal or extracellular loop regions

    • Avoid highly conserved transmembrane domains that may cross-react with other Mrgprs

  • Validation approaches:

    • Use knockout/knockdown controls

    • Compare multiple antibodies targeting different epitopes

    • Perform peptide competition assays

  • Alternative detection strategies:

    • Epitope tagging of recombinant receptors

    • RNA in situ hybridization to detect Mrgprh mRNA

    • Generation of reporter constructs driven by the Mrgprh promoter

What signaling assay platforms are most suitable for high-throughput screening of Mrgprh modulators?

Effective high-throughput screening platforms include:

  • Calcium mobilization assays:

    • FLIPR-based fluorescent calcium indicator assays

    • Aequorin-based luminescence assays

    • These are particularly relevant if Mrgprh couples to Gαq proteins

  • cAMP assays:

    • BRET/FRET-based cAMP sensors

    • GloSensor technology

    • Useful if Mrgprh couples to Gαs or Gαi proteins

  • β-arrestin recruitment:

    • Enzyme fragment complementation assays

    • BRET/FRET-based approaches

    • These can detect receptor activation regardless of G protein coupling

  • Receptor internalization:

    • High-content imaging platforms

    • pH-sensitive fluorescent tags that change intensity upon endocytosis

A multimodal approach employing several assay formats will provide the most comprehensive characterization of potential Mrgprh modulators.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.