Recombinant Rat Medium-wave-sensitive opsin 1 (Opn1mw)

Shipped with Ice Packs
In Stock

Description

Functional Significance in Visual Processing

Medium-wave-sensitive opsin 1 plays a critical role in the visual processing system of rats and other mammalian species, contributing significantly to color discrimination capabilities.

Role in Color Vision

The Opn1mw protein is primarily expressed in cone photoreceptors where it functions as a photopigment sensitive to medium wavelengths of light, corresponding to the green portion of the visible spectrum. Unlike humans who have distinct cone populations expressing either long (L), medium (M), or short (S) wavelength-sensitive opsins, most rodents including rats exhibit a different expression pattern. Rodent cones typically co-express both M- and S-opsins in a dorsal-ventral gradient, with dorsal cones predominantly expressing M-opsin and ventral cones predominantly expressing S-opsin .

Physiological Response Mechanisms

When medium-wavelength light activates the Opn1mw protein, it triggers a G-protein coupled cascade that ultimately leads to changes in membrane potential of cone photoreceptors. This initiates signal transmission to inner retinal neurons and eventual visual processing in the brain. The proper functioning of this pathway is essential for normal color vision and photopic (daylight) visual acuity .

Genetic Variants and Disease Models

Research into naturally occurring and engineered mutations of the Opn1mw gene has provided valuable insights into the molecular basis of color vision deficiencies.

Natural Mutations in Rat Models

A significant discovery in rat models was the identification of a naturally occurring X-linked mutant Sprague-Dawley rat with cone dysfunction. Investigation of this model revealed a G-to-T substitution at the splice acceptor site of intron 4 in the Opn1mw gene, resulting in down-regulated transcription and translation. This mutation manifested as abnormalities in the electroretinogram (ERG) response, specifically affecting cone-mediated visual function, although no significant histological changes were observed in the retinal structure .

This natural mutation model, termed the middle-wavelength opsin cone dysfunction (MCD) rat, exhibits visual deficiencies similar to color vision defects in humans without accompanying retinal degeneration. The preservation of retinal structure despite functional deficits makes this model particularly valuable for understanding the molecular mechanisms of color vision processing and developing potential therapeutic interventions .

Comparative Disease Associations

The rat Opn1mw gene shares homology with human medium and long-wavelength opsin genes that are associated with various color vision deficiencies. Based on homology studies, mutations in the rat Opn1mw gene have been linked to conditions similar to human blue cone monochromacy and red-green color blindness . These associations highlight the potential value of rat models in studying human color vision disorders.

Engineered Knockout Models

Beyond naturally occurring mutations, engineered knockout models have been developed to study the role of Opn1mw. While most research has been conducted in mice rather than rats, these studies provide insights applicable to rat Opn1mw function. For example, Opn1mw−/−/Opn1sw−/− double knockout mice (lacking both M-opsin and S-opsin) exhibit complete loss of cone-mediated visual function, demonstrating the essential role of these opsins in cone photoreceptor function .

Expression Systems and Purification

Recombinant rat Opn1mw protein is typically produced in heterologous expression systems that allow for proper folding and post-translational modifications essential for protein function. While specific expression systems for rat Opn1mw are not detailed in the search results, common platforms for opsin protein expression include mammalian cell lines, insect cells, and yeast systems. Purification strategies often incorporate affinity chromatography approaches utilizing protein tags determined during the production process .

Gene Therapy Approaches Targeting Opsin Expression

Advancements in gene therapy have opened new avenues for treating opsin-related visual disorders, with significant implications for conditions involving Opn1mw dysfunction.

Promoter Efficiency and Specificity

Several human cone opsin promoters have been evaluated for their effectiveness and specificity in directing cell-class-specific gene expression in photoreceptors. These include promoters derived from human red cone opsin genes (PR0.5, 3LCR-PR0.5, and PR2.1) and the human blue cone opsin gene (HB569). Research has shown varying degrees of specificity, with some promoters exhibiting more selective cone targeting than others .

The following table summarizes data related to human cone opsin promoter efficiency:

PromoterSpecies TestedCone-Specific ExpressionNotes
PR0.5Dog, RatLimitedHuman red cone opsin promoter
PR2.1Dog, RatStrong in L/M-conesContains locus control region (LCR)
HB569Dog, RatLimited, some non-specific expressionHuman blue cone opsin promoter
Combined PR2.1 & HB569Dog, RatStrong in L/M-cones, some non-specific expressionAttempting to target both cone classes

This research into promoter specificity provides valuable insights for developing targeted gene therapy approaches for opsin-related disorders in rats and potentially humans .

Therapeutic Applications in Opsin Deficiency Models

Studies in mouse models have demonstrated the potential of gene therapy for treating opsin deficiencies. In Opn1mw−/−/Opn1sw−/− mice (lacking both M-opsin and S-opsin), AAV-mediated expression of human L-opsin successfully promoted cone outer segment regeneration and rescued cone-mediated function when administered subretinally at early ages (2 months or younger). The therapeutic benefits were maintained for at least 8 months post-treatment, demonstrating the long-term efficacy of this approach .

Comparative Genomics and Evolution

Understanding the evolutionary context of the Opn1mw gene provides valuable insights into its functional significance across species.

Species Differences in Opsin Expression

Interestingly, while most rodents express Opn1mw, certain species show evolutionary adaptations in opsin gene expression. For example, the naked mole-rat (Heterocephalus glaber) is distinctive among rodents for missing two opsin genes, OPN1LW and OPN1MW, representing an evolutionary adaptation to its predominantly subterranean lifestyle .

Expression Patterns Across Species

Significant differences exist in cone opsin expression patterns between rodents and primates, including humans. Most rodent cones co-express both M- and S-opsin in a dorsal-ventral gradient, with dorsal cones predominantly expressing M-opsin and ventral cones predominantly expressing S-opsin. This pattern differs dramatically from human cones, which typically express only one type of opsin per cone cell . These species-specific expression patterns are critical considerations when translating research findings from rodent models to potential human applications.

Research Techniques and Methodologies

Various techniques have been developed and optimized for studying Opn1mw expression, function, and related pathologies in rat models.

Genetic and Molecular Characterization

Identification and characterization of Opn1mw mutations in rat models have employed molecular techniques including real-time PCR, immunohistochemistry, and various histological methods. For example, in the study of the naturally occurring MCD rat model, researchers used full-field electroretinogram (ERG) and simple sequence length polymorphism analyses, followed by candidate gene screening to identify the causative mutation in the Opn1mw gene .

Functional Assessment Methods

Functional assessment of cone-mediated vision in rats typically employs electroretinography (ERG), which measures the electrical responses of various cell types in the retina to light stimulation. The photopic (cone-mediated) ERG is particularly valuable for evaluating the functional consequences of Opn1mw mutations or therapeutic interventions .

Immunohistochemical Detection

Visualization of cone photoreceptors and assessment of opsin expression typically involve immunohistochemical techniques. Common approaches include the use of peanut agglutinin (PNA) to label cone photoreceptors and specific antibodies against opsin proteins. Advanced imaging techniques, such as confocal microscopy, enable detailed visualization of opsin expression patterns and localization within retinal tissue .

Future Research Directions and Implications

The study of recombinant rat Opn1mw continues to evolve, with several promising avenues for future research and application.

Therapeutic Development Potential

The successful demonstration of gene therapy approaches in opsin-deficient models provides a foundation for developing treatments for human color vision disorders. The identification of optimal promoters for cone-specific gene expression, combined with advances in viral vector delivery systems, offers promising therapeutic strategies for conditions such as blue cone monochromacy and other opsin-related visual disorders .

Comparative Functional Analysis

Further comparative studies between rat and human opsins could provide deeper insights into the molecular mechanisms underlying color vision and the pathophysiology of color vision defects. Understanding species-specific differences in opsin expression patterns and function is essential for translating findings from rodent models to human applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Opn1mw; Gcp; Medium-wave-sensitive opsin 1; Green cone photoreceptor pigment; Green-sensitive opsin; Medium wavelength-sensitive cone opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAQQLTGEQTLDHYEDSTQASIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSTWMILVVI ASVFTNGLVLAATMRFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFVLGHPL CVIEGYIVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLATVGIVFSWVWAAVWTA PPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIFPLSIIVLCYLQVWLA IRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFFACFATAHPGYAFHPLVAS LPSYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDSSELSSTSKTEVSSVSSVSPA
Uniprot No.

Target Background

Function
Visual pigments are light-absorbing molecules responsible for mediating vision. They comprise an apoprotein, opsin, covalently linked to cis-retinal. These pigments can enhance spectral sensitivity in dim light conditions.
Gene References Into Functions
  1. The deficiency in vision observed in the Opn1mw rat model resembles the color vision defects found in humans with color vision deficiencies, but without recessive retinal degeneration. PMID: 20371244
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in cone photoreceptor cells.

Q&A

What is Medium-wave-sensitive opsin 1 (Opn1mw) and what is its role in visual function?

Medium-wave-sensitive opsin 1 (Opn1mw) is a G-protein coupled receptor primarily expressed in cone photoreceptors of the retina. It plays a crucial role in color vision by detecting medium-wavelength (green) light. During visual transduction, Opn1mw activates the G-protein transducin (GNAT2), initiating a signaling cascade involving phosphodiesterase 6C (PDE6C). This cascade leads to hyperpolarization of the photoreceptor membrane and visual signal transmission. Mutations in Opn1mw can result in color vision deficiencies and cone dysfunction disorders .

How is Opn1mw expression regulated during retinal development?

Opn1mw expression follows a specific developmental pattern in rodent retinal tissue. Studies have shown that Opn1mw mRNA is present at normal levels at postnatal day 5 (P5) but may be reduced by approximately 42% by P15 and 44% by P30 in models with specific mutations like C198R . The expression is regulated by an upstream locus control region (LCR), which functions as an enhancer element essential for opsin gene expression . This regulatory mechanism creates an expression gradient, with genes closer to the LCR having higher expression levels, making the first two, most proximal gene copies most relevant for visual function .

What phenotypes are associated with Opn1mw mutations in animal models?

In mouse models carrying the C198R mutation (Opn1mwC198R Opn1sw–/–), several phenotypic changes have been observed:

  • Substantially shortened or missing cone outer segments (COS)

  • Dramatically decreased expression of phototransduction proteins (PDE6C and GNAT2)

  • Progressive loss of cone viability, with a 23% decrease by 3 months of age

  • Approximately 50% loss of dorsal cones and 25% loss of ventral cones by 6 months of age

  • Complete loss of cone function as measured by electroretinography (ERG)

These phenotypes resemble cone dystrophy, a progressive condition characterized by degeneration of cone photoreceptors and subsequent loss of color vision and visual acuity.

How does the C198R mutation affect Opn1mw protein trafficking and stability?

The C198R mutation in Opn1mw significantly impacts protein trafficking and stability. Research indicates that while mRNA levels of the mutant gene are only moderately reduced (by about 44% at P30), protein expression is dramatically decreased. This suggests that while the mutant protein is likely being translated, it subsequently undergoes degradation, preventing proper localization to the cone outer segments . Evidence supporting this includes:

  • Barely detectable PDE6C expression in mutant retinas

  • Dramatically decreased GNAT2 expression, with minimal staining localized within cone inner segments

  • Substantially shortened or missing cone outer segments in mutant retinas

These observations suggest that the C198R mutation causes protein misfolding, triggering cellular quality control mechanisms that lead to protein degradation and prevent proper trafficking to the outer segments, ultimately disrupting phototransduction cascade assembly.

What are the best methods for quantifying Opn1mw expression at both mRNA and protein levels?

For comprehensive analysis of Opn1mw expression, multiple complementary techniques should be employed:

For mRNA quantification:

  • Quantitative real-time PCR has been effectively used to analyze Opn1mw mRNA levels at different developmental stages (P5, P15, and P30)

For protein quantification and localization:

  • Immunohistochemistry (IHC) for detecting presence and localization of Opn1mw protein in retinal tissues

  • Immunoblot analysis (Western blotting) for assessing protein levels in retinal lysates

  • Cone density measurements using retinal whole mounts with specific markers (like PNA, which binds to cone sheaths) for quantitative assessment of cone survival

Combining these techniques allows researchers to correlate mRNA expression with protein levels and functional outcomes, which is particularly important when studying mutations that may affect post-translational processing and protein stability.

How can gene augmentation approaches be optimized for Opn1mw-related retinal disorders?

Based on recent research, successful gene therapy strategies for Opn1mw-related disorders have included the following key elements:

Delivery system and timing:

  • Using PR2.1-OPN1LW vector for gene delivery (likely an adeno-associated viral vector with a cone-specific promoter)

  • Administration at early disease stages (1 and 3 months of age) before significant cone degeneration occurs

Efficacy assessment:

  • Functional evaluation through electroretinography (ERG) at multiple time points post-injection

  • Structural assessment through immunohistochemistry examining cone morphology and expression of key phototransduction proteins

  • Biochemical analysis through immunoblotting of retinal lysates

Treatment outcomes data:
Gene augmentation has shown significant therapeutic potential, with treated animals demonstrating:

  • Restored cone function with b-wave maximum amplitude of 72.2 μV ± 13.3 μV at 1 month post-injection compared to no function in untreated controls

  • Elaborated cone outer segments

  • Proper localization of phototransduction proteins (L-/M-opsin, GNAT2, and PDE6C)

For optimizing such approaches, researchers should consider:

  • Timing of intervention (early intervention appears most effective)

  • Vector and promoter selection for specific targeting of cone photoreceptors

  • Dose optimization for sufficient expression without toxicity

  • Long-term follow-up protocols to assess therapeutic durability

What are the challenges in distinguishing Opn1mw from other opsin proteins in complex genetic backgrounds?

Distinguishing between different opsin proteins presents significant challenges due to several factors:

  • High sequence similarity between opsin genes (particularly OPN1LW and OPN1MW), including intronic and intergenic sequences

  • Presence of shared sequence variants occurring in both genes

  • Formation of hybrid genes (OPN1LWxOPN1MW or OPN1MWxOPN1LW)

  • Variable gene copy numbers among individuals (mean opsin gene copy number of 3.31 observed in unaffected males)

These complications make it difficult to determine the exact order of gene copies, which is crucial for understanding functional consequences of variants, as only the most proximal gene copies significantly contribute to the phenotype due to the expression gradient influenced by the locus control region (LCR) .

How do variations in the Opn1mw gene cluster affect gene expression and phenotype?

The opsin gene cluster structure significantly impacts gene expression patterns and resulting phenotypes:

  • The cluster consists of segmental duplications arranged as tandem low copy repeats with units approximately 39 kb in size

  • Proximity of gene copies to the LCR creates an expression gradient affecting functional outcomes

  • Gene copy number variability is common among individuals

  • Hybrid genes can alter spectral sensitivity properties

Understanding these variations is essential for accurate genetic diagnosis of color vision defects and cone disorders like Blue Cone Monochromacy (BCM), Bornholm Eye Disease (BED), and achromatopsia.

What are the best approaches for analyzing Opn1mw genetic variants when multiple gene copies exist?

Several advanced approaches have been developed for analyzing opsin genetic variants in the context of multiple gene copies:

Modern techniques:

  • Multiplex Ligation-Dependent Probe Amplification (MLPA) for determining copy number variations

  • Long-read sequencing of specific PCR amplicons covering different gene copies

  • Optical Genome Mapping (OGM) for resolving complex structural arrangements

  • Phasing-like SNP-based ordering of long sequencing reads from overlapping long-distance PCR fragments

Important considerations:
The determination of exact gene copy order and the corresponding location of deleterious variants is crucial for reliable genetic diagnosis. Traditional approaches analyzing only the proximal gene copies may miss important variations in cases with complex gene arrangements .

How do segmental duplications in the Opn1mw gene region impact genetic testing?

Segmental duplications (SDs) in the opsin gene region significantly complicate genetic testing:

Structural complexity:

  • The OPN1LW-OPN1MW gene cluster includes segmental duplications with a 697 bp insertion (SDIns) that can be present in variable numbers and positions

  • In a study of 52 individuals with three or more gene copies, 53.8% did not have the SDIns exclusively in the terminal SD copy as previously assumed

  • Multiple copies of SDIns were more common in clinical cases (60.8%) compared to non-affected probands (26.6%)

How can long-read sequencing improve the analysis of complex Opn1mw gene arrangements?

Long-read sequencing offers several advantages for analyzing complex opsin gene arrangements:

Technical benefits:

  • Spans entire gene copies, allowing determination of exact order and composition of multiple opsin genes

  • Resolves hybrid genes by capturing transition points between OPN1LW and OPN1MW sequences

  • Identifies precise location of deleterious variants within the gene cluster

  • Enables phasing of variants to determine whether they occur in the same or different gene copies

  • Detects structural rearrangements that might be missed by conventional sequencing approaches

Ultra-long reads that can cover the complete 154 kb sized OPN1LW-OPN1MW gene cluster, including all segmental duplications and insertions, represent the most comprehensive approach for genetic diagnostics in complex cases .

What control measures should be implemented when studying Opn1mw mutations?

When designing experiments to study Opn1mw mutations, several control measures should be incorporated:

Temporal controls:

  • Age-matched wild-type controls are essential, as demonstrated in studies comparing Opn1mw expression patterns between mutant and wild-type retinas at specific developmental timepoints (P5, P15, P30)

Spatial controls:

  • Analysis of both dorsal and ventral regions of the retina is important, as cone density and susceptibility to degeneration can vary between these regions, with studies showing approximately 50% of dorsal cones and 25% of ventral cones lost by 6 months in certain models

Molecular controls:

  • Examination of multiple components of the phototransduction cascade (Opn1mw, PDE6C, GNAT2) provides a more comprehensive understanding of the mutation's effects on the visual pathway

Functional controls:

  • Electroretinography (ERG) at different light intensities helps establish dose-response relationships and quantify functional deficits, with studies using light intensities up to 25 cd●s/m² to assess cone function

What considerations are important when interpreting data from Opn1mw gene therapy studies?

When interpreting results from gene therapy studies targeting Opn1mw-related disorders, researchers should consider:

Temporal factors:

  • The relationship between treatment timing and disease progression is critical, as interventions at 1 and 3 months of age have shown efficacy in animal models before substantial cone degeneration occurs

Functional assessment metrics:

  • ERG b-wave amplitude serves as a primary outcome measure, with successful therapy demonstrating values of 72.2 μV ± 13.3 μV at 1 month post-injection compared to no function in untreated controls

Structural recovery indicators:

  • Elaboration of cone outer segments

  • Replenishment of phototransduction proteins (L-/M-opsin, GNAT2, and PDE6C) to the cone outer segments

  • These structural changes should correlate with functional improvement as measured by ERG

Long-term efficacy:

  • Assessment at multiple timepoints post-intervention (1 month and 4 months) provides insights into the durability of the therapeutic effect

How should researchers interpret contradictory findings in Opn1mw genetic studies?

When facing contradictory findings in Opn1mw genetic studies, researchers should consider:

Technical limitations:

  • The high sequence similarity between opsin genes and presence of segmental duplications can lead to incorrect genotyping

  • Primer binding site polymorphisms (like SDIns) can result in amplification biases and false interpretations

Genetic complexity:

  • Variable gene copy numbers and hybrid genes may explain phenotypic differences among individuals with apparently similar genotypes

  • The position effect of variants within the gene cluster significantly impacts phenotypic expression due to the influence of the LCR

Methodological differences:

  • Different testing approaches (MLPA, long-read sequencing, OGM) may yield different results depending on their ability to resolve complex structural arrangements

  • The order of gene copies determined by different methods may be inconsistent if they rely on different assumptions about the structure of the gene cluster

To resolve contradictions, researchers should employ complementary approaches and consider the biological context when interpreting genetic findings.

What statistical approaches are most appropriate for analyzing Opn1mw expression data?

When analyzing Opn1mw expression data, researchers should consider:

For quantitative comparisons:

  • Statistical significance testing with appropriate corrections for multiple comparisons

  • Studies have successfully used measures like cone density (cones/mm²) to quantify phenotypic effects, with wild-type mouse retina typically showing between 10,000 and 14,000 cones/mm²

For temporal analyses:

  • Longitudinal statistical methods to track changes over time

  • Studies have shown progressive cone loss, with 23% decrease by 3 months and approximately 50% of dorsal cones lost by 6 months of age

For therapeutic effect evaluation:

  • Paired statistical tests comparing pre- and post-intervention measures

  • Comparison of treatment groups at multiple timepoints to assess durability of effect

  • Analysis of dose-response relationships for therapeutic interventions

A comprehensive statistical approach should account for regional variations in the retina, temporal progression of disease, and multiple functional and structural outcome measures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.