Recombinant Rat Melanin-concentrating hormone receptor 1 (Mchr1)

Shipped with Ice Packs
In Stock

Description

Signaling Mechanisms

Mchr1 couples to multiple G proteins, enabling diverse downstream effects:

  • Gi/o pathway: Reduces cAMP levels via adenylyl cyclase inhibition

  • Gq pathway: Stimulates intracellular Ca²⁺ flux

  • MAPK activation: Triggers ERK phosphorylation

Internalization dynamics (HEK293T cell studies) :

ConditionInternalization Rate
Wild-type Mchr170% in 30 min
C-terminal truncation mutants≤30% in 30 min

Energy Homeostasis

  • Acute MCH administration increases food intake by 200–300% in fasted rats

  • Chronic activation promotes fat mass accumulation

Lactation Regulation

  • Mammary gland expression:

    • Peak Mchr1 mRNA levels occur at postpartum day 19 (PPD19)

    • Localizes to alveolar secretory cells (immunohistochemistry)

Lactation StageMCHR1 Protein Levels
Early lactationModerate
PPD193× baseline
Post-weaningUndetectable

Recombinant Protein Production

Available expression systems for rat Mchr1 :

SystemTag OptionsPurity
HEK293His, Fc, Avi≥90%
E. coliGST70–80%

Detection Kits

Rat Mchr1 ELISA Kit (Assay Genie RTEB0701) :

ParameterSpecification
Detection range0.78–50 ng/mL
Sensitivity0.394 ng/mL
Intra-assay CV5.1%
ApplicationsSerum, plasma, lysates

Pharmacological Modulation

  • Antagonists: Reduce body weight by 15–20% in obese rodent models

  • Internalization inhibitors: Dominant-negative β-arrestin-2 blocks 60% of receptor trafficking

Key phosphorylation sites affecting internalization:

ResidueFunctional Impact
Thr317Reduces PKC-dependent uptake
Ser325Impairs β-arrestin-2 recruitment
Thr342Critical for dynamin I binding

Emerging Research Applications

  1. Mammary gland involution studies: Mchr1 knockdown accelerates post-weaning tissue remodeling

  2. Anxiety/depression models: Mchr1 antagonists show 40–50% reduction in rodent anxiety behaviors

  3. Metabolic syndrome: Dual MCHR1/leptin receptor agonists under preclinical evaluation

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate your requirement during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We recommend storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% of glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
Mchr1; Gpr24; Slc1; Melanin-concentrating hormone receptor 1; MCH receptor 1; MCH-R1; MCHR-1; G-protein coupled receptor 24; MCH-1R; MCH1R; MCHR; SLC-1; Somatostatin receptor-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
QATCTGCMDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLL GIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGE TMCTLITAMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFI SITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQ RMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLY NAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
Uniprot No.

Target Background

Function
Melanin-concentrating hormone receptor 1 (Mchr1) is a G protein-coupled receptor that inhibits adenylyl cyclase activity. It acts as a receptor for melanin-concentrating hormone (MCH), a neuropeptide involved in various physiological functions.
Gene References Into Functions
  1. Research suggests a dual role of MCH and MCH1-R in regulating alcohol intake, potentially through mechanisms involving caloric intake and reward motivation. PMID: 27579857
  2. Studies have examined MCH levels in cerebrospinal fluid, brain preproMCH and MCHR1 gene expression during paradoxical sleep deprivation, sleep rebound, and chronic sleep restriction in rats. PMID: 26456505
  3. This study identified the amino acids selectively involved in Gi/o activation by rat melanin-concentrating hormone receptor 1. PMID: 25617691
  4. Data indicates that Mch/Mchr1 signal transduction participates in the modulation of depression-like behavior through processes in the CA1 region of the hippocampus. A model of depression involves chronically higher Mch expression and down-regulation of Mchr1. PMID: 22209364
  5. Diet-induced obesity and associated metabolic disorders may be correlated with up-regulated expression of MCHR1 and down-regulated expression of OB-Rb in adipose tissue. PMID: 21946196
  6. Data suggests that MCH and its receptor (MCHR1) form an orexigenic system whose expression is affected in conditioned taste aversion. MCHR1 expression is up-regulated in the hypothalamus and brain stem (and possibly amygdala) of aversive animals. PMID: 21925200
  7. The basic residues in the membrane-proximal C-terminal tail of the rat melanin-concentrating hormone receptor 1 are essential for receptor function. PMID: 15117878
  8. MCH1R undergoes rapid melanin-concentrating hormone-induced internalization, and a portion of the C-terminal tail plays a significant role in the internalization process. PMID: 15476926
  9. Periplakin interferes with G protein activation by the melanin-concentrating hormone receptor-1 by binding to the proximal segment of the receptor C-terminal tail PMID: 15590649
  10. Castration and testosterone treatment on the vasculature in the ventral prostate in adult rats and mice alter the expression of this protein. PMID: 15845622
  11. These data support the notion that MIZIP might interact with melanin-concentrating hormone receptor 1 (MCHR1) in a cell type-specific manner in vivo, suggesting a role in the regulation of MCH signaling in distinct regions of the mammalian brain. PMID: 15950311
  12. In nodose ganglia from rats fasted for 24 hours, RT-PCR revealed the expression of both melanin-concentrating hormone and MCHR1, whereas in nodose ganglia from animals fed ad libitum, expression was virtually undetectable. PMID: 16359819
  13. The results support a role of the melanin-concentrating hormone MCH(1) receptor in the regulation of the deep slow-wave sleep-REM sleep cycle. PMID: 18062961
  14. RGS8, which is highly expressed in the brain, functions as a negative modulator of MCH1R signaling. PMID: 18760349
  15. SNAP79441 inhibits this receptor and reduces the micturition response in rats. PMID: 18849359
  16. Data suggests that the major contribution of the DRY motif in MCH1R is to govern receptor conformation and G protein coupling/recognition. PMID: 19428776

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
High level in the brain, moderate amounts in the eye and skeletal muscle, and small amounts in tongue and pituitary.

Q&A

How does MCHR1 expression change during different physiological states?

MCHR1 expression exhibits dynamic regulation across different physiological states. In mammary tissue, both Mchr1 mRNA and MCHR1 immunoreactivity show distinct patterns during lactation. Sparse immunolabeling is observed in undeveloped parenchyma of diestrus rats, while during lactation, MCHR1-immunoreactive cells are found bordering the acini and in the ducts of mammary alveoli. Notably, there is an increasing pattern of MCHR1 distribution in the luminal part of the acini along and at the end of lactation, particularly evident at postpartum day 19 . This suggests MCHR1 may play a regulatory role in milk production and secretion during the postpartum period.

What methodologies are most effective for detecting rat MCHR1 expression?

Several complementary techniques have proven effective for detecting rat MCHR1:

  • In situ hybridization (ISH): Using [35S]-labeled antisense Mchr1 riboprobes (comprising nucleotides 30-1061 of rat Mchr1 mRNA) to detect mRNA expression in tissue sections . The methodology typically involves:

    • Pretreatment of free-floating brain sections with sodium citrate buffer

    • Incubation with riboprobes at 60°C for 18 hours

    • Sequential washes with increasing stringency of sodium citrate buffer

    • Exposure to X-ray film for approximately 5 days

  • Immunofluorescence: Using indirect immunofluorescence with specific antibodies against MCHR1, counterstained with DAPI for nuclear visualization .

  • Quantitative PCR and Western blotting: These techniques provide quantitative assessment of mRNA and protein expression levels, respectively, showing correlation with immunohistochemical observations .

What are the primary signaling pathways associated with rat MCHR1 activation?

Rat MCHR1 exhibits complex signaling mechanisms that involve multiple G-protein coupling pathways:

  • Inhibitory pathway: MCHR1 primarily couples through Gαi/o proteins, leading to inhibition of adenylyl cyclase and subsequent reduction in cAMP levels .

  • MAPK pathway activation: The receptor may couple through either Gαo or Gαq/11 to activate mitogen-activated protein kinases (MAPK), including extracellular-signal related protein kinases 1 and 2 (ERK1/2) through the Ras/Raf pathway .

  • PLC/PKC pathway: MCHR1 can activate phospholipase C/protein kinase C (via Gαq), stimulating production of inositol trisphosphate (IP3) and increasing intracellular calcium concentrations, which contributes to neuronal excitability .

The complexity of these signaling cascades helps explain the multifaceted functions of the MCH system in various physiological processes. Depending on the intracellular coupling of receptors in postsynaptic neurons and the co-release of other neurotransmitters, MCHR1 activation may produce either inhibitory or excitatory effects on downstream neural circuits .

How do MCHR1 structure-activity relationships inform pharmacological targeting?

Structure-activity relationship studies with MCH analogs have provided valuable insights into receptor pharmacology:

  • Correlation of binding and function: There is a strong correlation between binding affinities and functional potencies in cAMP assays for MCH analogs, with peptides classified into several potency groups ranging from subnanomolar activity to complete inactivity .

  • Translational relevance: Data obtained with rat recombinant MCHR1 show high correlation with those from its human counterpart, supporting the translational value of rat models .

  • Functional significance: A strong correlation exists between the in vitro potency of MCH analogs at the SLC-1 receptor and their effects on food intake when injected intracerebroventricularly in rats, establishing the relevance of MCHR1 in feeding behavior .

This pharmacological characterization provides a foundation for developing targeted MCHR1 antagonists like AZD1979, which has shown promise in obesity treatment research .

What is the significance of MCHR1 in rat feeding behavior?

MCHR1 plays a crucial role in regulating feeding behavior and energy homeostasis in rats. Studies have established that:

  • MCH acts as an orexigenic peptide in rats, stimulating food intake when administered centrally .

  • Structure-activity relationship studies with MCH analogs have demonstrated a strong correlation between their potency at the rat SLC-1 (MCHR1) receptor and their effects on food intake, directly establishing the receptor's role in feeding behavior .

  • Conditional deletion of MCHR1 from specific neuronal populations results in lower body weight and increased energy expenditure, further supporting its critical role in energy balance regulation .

This evidence collectively confirms MCHR1 as a key mediator of MCH's orexigenic effects, making it an important target for anti-obesity research.

How do MCHR1 knockout models inform our understanding of energy homeostasis?

Conditional MCHR1 knockout models have provided valuable insights into the receptor's role in energy balance:

  • GABAergic neuron-specific deletion: Vgat-Mchr1-KO mice (with MCHR1 deleted from GABAergic neurons expressing the vesicular GABA transporter) display:

    • Lower body weight

    • Increased energy expenditure

    • Significantly elevated locomotor activity

  • Nucleus accumbens-specific deletion: Restricting MCHR1 deletion to the accumbens nucleus through AAV-Cre delivery in Mchr1-flox mice results in increased locomotor activity, suggesting region-specific functions .

  • Dopaminergic mechanisms: MCHR1 deletion appears to create a hyperdopaminergic state that mediates the observed hyperactivity, as evidenced by increased sensitivity to GBR12909 (a dopamine reuptake blocker) and elevated dopamine levels in the accumbens .

These findings reveal that MCHR1 in specific neuronal populations critically regulates energy balance through modulation of both feeding behavior and physical activity levels.

What translational models link rat MCHR1 studies to human obesity research?

Translational modeling approaches connecting rat MCHR1 studies to human obesity research include:

  • Integrated biomarker modeling: Models that quantitatively connect relevant biomarkers across species, creating a scaling path from rodent to human and from dose to effect level .

  • Body composition models: Semi-mechanistic body-composition models have been developed that can predict energy intake from longitudinal body-weight data across species .

  • Pharmacological translation: MCHR1 antagonists like AZD1979 have been developed using translational modeling approaches that integrate data from cellular assays, animal studies, and human clinical trials .

The complexity of these models varies depending on data quality, quantity, and prior information, ranging from semi-mechanistic body-composition models to standard linear regression approaches. These translational frameworks are essential for guiding experimental design and human dose prediction in obesity treatment research .

How can conditional MCHR1 knockout models be generated for specific research questions?

Generation of conditional MCHR1 knockout models involves several key steps:

  • Creation of Mchr1-flox mice: These mice contain loxP sites flanking critical regions of the Mchr1 gene, allowing for Cre-mediated excision in specific cell populations .

  • Cell-type specific targeting: Crossing Mchr1-flox mice with appropriate Cre-driver lines enables deletion of MCHR1 from specific neuronal populations. For example, crossing with Vgat-cre mice produces Vgat-Mchr1-KO mice with MCHR1 deleted from GABAergic neurons expressing vGAT .

  • Region-specific targeting: Local delivery of adeno-associated viruses expressing Cre recombinase to specific brain regions (e.g., nucleus accumbens) in Mchr1-flox mice allows for anatomically restricted MCHR1 deletion .

  • Validation: Successful deletion should be confirmed using techniques such as in situ hybridization with [35S]-labeled antisense Mchr1 riboprobes to visualize changes in expression patterns .

This approach enables precise dissection of MCHR1 functions in specific neural circuits and cell populations, facilitating detailed investigation of its role in various physiological processes.

What in vitro assays are most informative for studying MCHR1 pharmacology?

Several complementary in vitro assays provide valuable insights into MCHR1 pharmacology:

  • cAMP inhibition assays: These measure the Gαi/o-mediated inhibition of adenylyl cyclase activity following MCHR1 activation, providing a functional readout of receptor activity .

  • Radioligand binding assays: Using ligands such as [125I]S36057 to measure binding affinities of various compounds to MCHR1. Notably, agonist potencies in cAMP assays strongly correlate with binding affinities .

  • MAPK pathway activation assays: Measuring phosphorylation of ERK1/2 provides insights into the activation of this signaling cascade downstream of MCHR1 .

  • Calcium mobilization assays: These detect increases in intracellular calcium concentrations following activation of the PLC/PKC pathway via Gαq coupling .

  • Receptor interaction studies: Investigating synergistic interactions between MCHR1 and other GPCRs (e.g., dopamine D1 and D2 receptors) when co-activated in the same neuron .

These assays collectively enable comprehensive characterization of MCHR1 pharmacology, facilitating the discovery and development of selective modulators for research and potential therapeutic applications.

How does MCHR1 modulate dopaminergic neurotransmission?

MCHR1 plays a significant role in regulating dopaminergic neurotransmission, particularly in reward-related brain regions:

  • Inhibitory effects on dopamine release: Amperometry recordings have revealed that MCH acutely suppresses dopamine release within the nucleus accumbens, suggesting a direct modulatory role .

  • Effects of MCHR1 deletion: Genetic deletion of MCHR1 from GABAergic neurons leads to a hyperdopaminergic state, as evidenced by:

    • Increased baseline locomotor activity

    • Enhanced and prolonged sensitivity to GBR12909-induced locomotor stimulation

    • Elevated dopamine levels in the accumbens (reaching twice that of controls) following GBR12909 administration

  • Receptor interactions: Complex synergistic interactions have been observed when MCHR1 is co-activated with dopamine receptors (D1 and D2) in nucleus accumbens neurons, possibly mediated by Gβγ subunit activity .

These findings suggest that MCHR1 normally functions to restrain dopaminergic tone, particularly in the nucleus accumbens, with implications for understanding behaviors related to reward, motivation, and locomotor activity.

What is the role of MCHR1 in anxiety and depression-related behaviors?

MCHR1 appears to play a complex role in anxiety and depression-related behaviors:

  • Anxiogenic/depressive effects of MCH: Intracerebroventricular infusion of MCH peptide, or local infusion into mood-regulating brain structures, generally induces or enhances anxiety and depression-like behaviors in rodents .

  • Anxiolytic/antidepressant effects of MCHR1 antagonists: Systemic or intracerebral administration of MCHR1 antagonists produces anxiolytic and antidepressant-like effects in various rodent behavioral assays .

  • Conflicting findings: Some studies have reported contradictory results, with a few early and one recent study reporting anxiolytic or antidepressant effects of MCH . Additionally, one study failed to replicate previously reported effects of certain MCHR1 antagonists and suggested some effects might be mediated by off-target receptor interactions (particularly 5HT1A receptor agonism) .

  • Route-dependent effects: The effects of exogenous MCH may vary depending on the route of administration. Chronic intranasally-administered MCH peptide has been reported to produce dose-dependent anxiolytic and antidepressant effects, contrasting with the anxiogenic effects typically observed with other administration routes .

These findings highlight the complex and context-dependent role of the MCH system in mood regulation, warranting careful experimental design when investigating this aspect of MCHR1 function.

What is the significance of MCHR1 expression in the rat mammary gland?

The discovery of MCHR1 expression in the rat mammary gland represents a novel site of peripheral action for the MCH system:

  • Expression patterns: Both Mchr1 mRNA and MCHR1 immunoreactivity are present in the mammary glandular parenchyma, with expression changing across reproductive stages. Expression is sparse in undeveloped parenchyma of diestrus rats but increases during lactation, particularly in cells bordering and within the luminal part of the acini .

  • Cellular localization: Within the parenchyma, MCHR1 is found co-distributed with the acini (external layer) and is most prevalent in the secretory cuboid cells lining the acinus lumen, particularly in lactating rats at postpartum day 19 .

  • Functional implications: The dual presence of MCHR1 in myoepithelial cells surrounding the acini and in secretory cells suggests a potential role in regulating both milk ejection and secretion functions. Through myoepithelial cells, MCH may modulate milk ejection synergistically with oxytocin, while in secretory cells, it may interact with the prolactin system .

  • Developmental regulation: The increasing pattern of MCHR1 expression throughout lactation suggests a role in mammary gland development and maintenance during the postpartum period, potentially similar to MCH's biphasic role in maternal behavior .

This peripheral expression of MCHR1 expands our understanding of the MCH system beyond its central functions and suggests potential involvement in lactation and mammary gland physiology.

How does peripheral MCHR1 expression differ from central expression patterns?

While central MCHR1 expression has been extensively characterized, peripheral expression patterns show distinct features:

  • Tissue specificity: Peripheral MCHR1 expression shows higher tissue specificity compared to the widespread but regionally variable expression in the central nervous system. Notable peripheral expression has been documented in the mammary gland during lactation and in certain immune cell populations .

  • Developmental regulation: Peripheral MCHR1 expression shows marked developmental and physiological state-dependent regulation. In the mammary gland, expression increases throughout lactation, peaking at later stages (postpartum day 19), suggesting a role in tissue maturation and functional regulation .

  • Functional context: While central MCHR1 is primarily involved in regulating feeding behavior, energy homeostasis, and mood , peripheral MCHR1 may serve more specialized functions related to the specific tissues where it is expressed, such as modulating milk production and secretion in the mammary gland .

  • Co-expression with other signaling systems: In peripheral tissues, MCHR1 may interact with tissue-specific signaling systems. For example, in the mammary gland, MCHR1 may interact with the prolactin system in secretory cells and the oxytocin system in myoepithelial cells .

These differences highlight the versatility of the MCH system and suggest that peripheral MCHR1 may represent an underexplored target for specific physiological functions beyond the well-established central roles.

How can rat MCHR1 studies inform human drug development?

Rat MCHR1 studies provide valuable translational insights for human drug development:

  • Pharmacological correlation: Data obtained with rat recombinant MCHR1 show high correlation with those from its human counterpart, supporting the translational value of rat models for screening MCHR1-targeted compounds .

  • Quantitative modeling frameworks: Translational modeling approaches have been developed that integrate data from cells, animals, and humans to guide study design and dose prediction for MCHR1 antagonists. These models connect biomarkers across species, facilitating scaling from rodent to human .

  • Predictive biomarkers: Semimechanistic body-composition models derived from rat studies can predict human responses, such as inferring energy intake trajectories from longitudinal body weight data .

  • Mechanistic insights: Understanding of rat MCHR1 signaling mechanisms provides insights into potential on-target and off-target effects in humans, guiding the development of more selective compounds .

The translational value of rat MCHR1 research is exemplified by the development of antagonists like AZD1979, where modeling approaches integrated data across species and provided quantitative predictions of human efficacy .

What are the main challenges in translating MCHR1 findings to clinical applications?

Despite promising preclinical results, several challenges exist in translating MCHR1 findings to clinical applications:

  • Contradictory findings: Some studies have reported contradictory results regarding the effects of MCH and MCHR1 antagonists, particularly in anxiety and depression models. For example, while most studies suggest anxiogenic effects of MCH and anxiolytic effects of MCHR1 antagonists, some studies report opposite findings .

  • Off-target effects: Concerns have been raised that some reported effects of MCHR1 antagonists might be mediated by off-target receptor interactions, particularly 5HT1A receptor agonism, similar to the mechanism of FDA-approved anxiolytic buspirone .

  • Route-dependent effects: The effects of MCH may vary depending on administration route, with intranasal administration potentially producing effects opposite to those observed with other routes .

  • Complexity of signaling pathways: MCHR1 couples to multiple G-proteins and activates various signaling pathways, making it challenging to develop compounds with specific desired effects without unwanted consequences .

  • Integration with other systems: MCHR1 interacts with multiple neurotransmitter systems, including dopaminergic and GABAergic systems , complicating the prediction of net effects when targeting this receptor in complex neural circuits.

Addressing these challenges requires careful experimental design, comprehensive pharmacological characterization, and sophisticated translational modeling approaches to guide clinical development of MCHR1-targeted therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.