Recombinant Rat Melanocortin receptor 4 (Mc4r)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Rat Melanocortin Receptor 4

Melanocortin receptor 4 belongs to the family of G protein-coupled receptors (GPCRs) that specifically bind to the heptapeptide core common to adrenocorticotropic hormone (ACTH) and alpha-, beta-, and gamma-melanocyte stimulating hormone (MSH) . In rats, the Mc4r is encoded by an intronless gene and plays a central role in energy homeostasis and somatic growth . The receptor functions through G proteins that stimulate adenylate cyclase, leading to increased cyclic adenosine monophosphate (cAMP) production . This signaling pathway is crucial for mediating the effects of melanocortins on various physiological functions, including food intake, energy expenditure, and glucose metabolism .

Rat Mc4r consists of 332 amino acids with an estimated molecular weight of approximately 40 kDa, though the protein undergoes heavy glycosylation that can cause it to appear at multiple positions on SDS-PAGE . Unlike many other GPCRs, Mc4r lacks the highly conserved disulfide bridge between extracellular loop 2 (EL2) and transmembrane domain 3 (TM3) . Instead of a cysteine at position 3.25 in TM3, rat Mc4r has an aspartate (D122), which forms part of a ligand and calcium-binding network .

Tissue Distribution and Expression

Extensive localization studies have demonstrated that Mc4r mRNA is widely expressed throughout the adult rat brain . High expression levels are observed in the cortex, thalamus, hypothalamus, brainstem, and spinal cord . Within the hypothalamus, Mc4r is particularly abundant in the paraventricular nucleus (PVN), including both parvicellular and magnocellular neurons . This expression pattern has been confirmed using both in situ hybridization techniques and transgenic mice expressing green fluorescent protein under the control of the Mc4r promoter .

Beyond neuronal expression, rat Mc4r is also present in astrocytes . Studies have shown that both endogenous and synthetic peptide ligands, as well as small molecule agonists, can increase cAMP accumulation in rat astrocytes, consistent with earlier findings that α-MSH and ACTH elevate cAMP levels in astroglial cells .

Production and Purification of Recombinant Rat Mc4r

The production of recombinant rat Mc4r involves several sophisticated biotechnological approaches, aimed at generating sufficient quantities of the protein for structural and functional studies.

Expression Systems

Recombinant rat Mc4r can be produced using various expression systems, including:

  1. Bacterial Expression (E. coli): Often used with fusion proteins to enhance solubility

  2. Yeast Expression: Provides proper protein folding and post-translational modifications

  3. Mammalian Cell Expression (HEK293): Offers the most physiologically relevant post-translational modifications and protein folding

The choice of expression system depends on the specific research requirements, with mammalian systems typically preferred for functional studies due to their ability to properly fold and modify membrane proteins like Mc4r .

Purification Techniques

Purification of recombinant rat Mc4r typically involves several steps:

  1. Cell Lysis: Ultrasonication to release the expressed protein from host cells

  2. Affinity Chromatography: Ni-NTA affinity chromatography for His-tagged proteins

  3. Chemical Cleavage: CNBr treatment to remove fusion tags, with optimized reaction times of approximately 2 hours to balance yield and purity

  4. SDS Removal: Precipitation methods using KCl to remove SDS bound to proteins

  5. Dialysis and Lyophilization: For buffer exchange and concentration

Optimized protocols have achieved purities exceeding 85% as determined by SDS-PAGE . The purified protein is typically stored with 5-50% glycerol at -20°C/-80°C to maintain stability, with lyophilized preparations showing shelf lives of up to 12 months .

Transmembrane Structure

Advanced structural studies, including solid-state NMR spectroscopy performed in anisotropic phospholipid bicelles, have provided insights into the membrane integration of rat Mc4r . The 1D 1H-15N CP (Cross Polarization) solid-state NMR spectra suggest that transmembrane domains of Mc4r undergo rotational diffusion around an axis perpendicular to the bilayer normal , providing important information about the receptor's dynamic behavior within the cell membrane.

Physiological Functions of Rat Mc4r

Rat Mc4r has been implicated in numerous physiological processes, with extensive research focusing on its role in energy homeostasis and metabolic regulation.

Energy Homeostasis and Body Weight Regulation

Recombinant rat Mc4r has been instrumental in elucidating the central role of melanocortin signaling in energy balance. Knockout studies have demonstrated that functional loss of Mc4r leads to significant obesity phenotypes characterized by:

  1. Increased body weight

  2. Elevated food intake

  3. Expanded white adipose mass

  4. Altered substrate preference

The importance of Mc4r in energy homeostasis is further supported by intracerebroventricular (ICV) administration studies using Agouti-Related Protein 79-129 (AgRP 79-129), an Mc4r inverse agonist, and Melanotan-II (MTII), an Mc4r agonist . These interventions significantly affect feeding behavior in wild-type rats but show no effect in homozygous Mc4r mutant rats, confirming the complete loss of Mc4r function in these animals .

Glucose and Insulin Homeostasis

Recombinant rat Mc4r has also been crucial in understanding the role of central melanocortin signaling in glucose metabolism. Studies have shown that:

  1. Mc4r knockout rats exhibit marked hyperglycemia and hyperinsulinemia

  2. Re-expression of Mc4r in cholinergic neurons can ameliorate both hyperglycemia and hyperinsulinemia

  3. Mc4r signaling in brainstem neurons, including those in the dorsal motor nucleus of the vagus, is sufficient to attenuate hyperinsulinemia

These findings suggest that Mc4r expressed by cholinergic neurons regulates both energy expenditure and hepatic glucose production, providing evidence for the dissociation of pathways mediating the effects of melanocortins on energy balance and glucose homeostasis .

Sexual Behavior and Reproduction

Recent studies using recombinant rat Mc4r have expanded our understanding of melanocortin signaling in reproductive behaviors. Research has demonstrated that:

  1. Mc4r knockout mice exhibit reduced approach toward males and decreased receptivity to copulation (low lordosis quotient)

  2. These changes in sexual behavior are independent of body weight

  3. Restoration of Mc4r expression in specific neuronal populations can normalize these behavioral deficits

These findings implicate Mc4r signaling in Oxytocin neurons in appetitive behaviors and Mc4r signaling in Sim1 neurons in female sexual receptivity, suggesting that melanocortin-driven sexual function does not rely on metabolic neural circuits .

Stress Response

The relationship between stress and Mc4r expression has been explored using recombinant rat Mc4r. Studies have shown that:

  1. Chronic restraint stress significantly increases Mc4r mRNA expression in the arcuate nucleus (ARC) of the hypothalamus

  2. This increase in Mc4r expression due to chronic stress was not associated with changes in body weight

  3. The glucocorticoid receptor antagonist RU486 did not affect the stress-induced increase in Mc4r expression

These findings suggest that Mc4r plays a role in the neural response to chronic stress, potentially influencing stress-related behaviors and metabolic adaptations.

Experimental Applications of Recombinant Rat Mc4r

Recombinant rat Mc4r has been utilized in various experimental contexts to advance our understanding of melanocortin signaling and develop potential therapeutic interventions.

Functional Assays

Several experimental approaches have been developed to assess the functionality of recombinant rat Mc4r:

  1. cAMP Accumulation Assays: Measuring the ability of Mc4r to activate adenylyl cyclase and increase intracellular cAMP levels in response to agonist stimulation

  2. Ligand Binding Assays: Determining the affinity and specificity of various ligands for the receptor

  3. ELISA-Based Detection: Quantifying Mc4r levels in serum, plasma, and cell culture supernatants using specific antibodies

These assays provide valuable tools for screening potential therapeutic compounds and understanding the molecular mechanisms of Mc4r function.

Genetic Manipulation Models

Various genetic models have been developed using recombinant rat Mc4r to study its function in vivo:

  1. Complete Knockout Models: Functional loss of Mc4r resulting from N-ethyl-N-nitrosourea mutagenesis-induced point mutations

  2. Conditional Re-expression Models: Selective restoration of Mc4r expression in specific neuronal populations using Cre-loxP technology

    • ChAT-Cre, loxTB Mc4r mice (re-expression in all cholinergic neurons)

    • Phox2b-Cre, loxTB Mc4r mice (re-expression primarily in parasympathetic neurons)

    • Sim1-Cre, loxTB Mc4r mice (re-expression in Sim1-expressing neurons)

    • Oxt-Cre, loxTB Mc4r mice (re-expression in oxytocin neurons)

These models have been instrumental in dissecting the neural circuits through which Mc4r regulates various physiological functions.

Pathophysiological Implications and Clinical Significance

Research using recombinant rat Mc4r has provided significant insights into the pathophysiology of various disorders and potential therapeutic interventions.

Obesity and Metabolic Disorders

Mutations in the Mc4r gene represent the most common monogenic form of human obesity, with more than 150 distinct mutations reported . Studies using recombinant rat Mc4r have shown that:

  1. Functional loss of Mc4r leads to obesity characterized by hyperphagia, increased adiposity, hyperinsulinemia, and hyperleptinemia

  2. Different mutations can affect receptor function through various mechanisms, including impaired membrane binding and subsequent non-functionality

  3. The recombinant D90N mutant Mc4r exhibits normal cell surface expression and agonist binding but shows loss of signal transduction via Gs/adenylyl cyclase activation

These findings highlight the potential of Mc4r as a therapeutic target for obesity and associated metabolic disorders.

Other Associated Conditions

Beyond obesity, recombinant rat Mc4r research has implicated this receptor in various other conditions:

ConditionRelationship to Mc4rReference
Diabetes mellitusAssociated with monogenic diabetes
SchizophreniaPotential involvement in neuropsychiatric function
Chromosome 18q deletion syndromeGenetic association
Cone-rod dystrophyGenetic association
ImmunodeficiencyGenetic association

These associations suggest that Mc4r may have broader clinical implications beyond its established role in energy homeostasis.

Future Research Directions

The continued study of recombinant rat Mc4r holds promise for several important research directions:

Neural Circuit Mapping

The use of conditional re-expression models has begun to map the neural circuits through which Mc4r regulates various physiological functions. Future research could:

  1. Further delineate the specific neuronal populations that mediate different aspects of Mc4r function

  2. Explore the interactions between Mc4r-expressing neurons and other neural systems

  3. Investigate the developmental aspects of Mc4r expression and function

Such studies would provide a more comprehensive understanding of how melanocortin signaling coordinates various physiological processes.

Therapeutic Applications

The development of therapeutic interventions targeting Mc4r remains an active area of research. Future directions might include:

  1. Personalized approaches based on specific Mc4r mutations

  2. Combination therapies targeting multiple components of the melanocortin system

  3. Tissue-specific delivery systems to minimize off-target effects

These approaches could lead to more effective treatments for obesity and associated metabolic disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please specify your needs when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mc4r; Melanocortin receptor 4; MC4-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MNSTHHHGMYTSLHLWNRSSHGLHGNASESLGKGHSDGGCYEQLFVSPEVFVTLGVISLL ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS GVLFIIYSDSSAVIICLITMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGAN MKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPL IYALRSQELRKTFKEIICFYPLGGICELPGRY
Uniprot No.

Target Background

Function
Melanocortin receptor 4 (MC4R) is a receptor specifically designed for the heptapeptide core common to adrenocorticotropic hormone (ACTH) and alpha-, beta-, and gamma-melanocyte-stimulating hormone (MSH). It plays a crucial role in energy homeostasis and somatic growth. This receptor is mediated by G proteins that stimulate adenylate cyclase (cAMP), leading to downstream signaling pathways.
Gene References Into Functions
  1. MC3R deficiency led to a reduction in food intake and body weight, while simultaneously exhibiting additive effects on top of MC4R deficiency on lipid and glucose metabolism. PMID: 27713523
  2. This study demonstrated that Adolescent Alcohol Exposure-Induced Changes in melanocortin 4 receptor. PMID: 28575455
  3. Results revealed that MC4R activation was able to attenuate oxidative stress and mitochondrial dysfunction in skeletal muscle induced by diabetes partially through activating the AMPK-SIRT1-PGC-1alpha signaling pathway. PMID: 28409883
  4. Although MC4R obese pregnant rats had elevated blood pressure associated with reduced total NOS activity and expression, they had enhanced NOS-mediated attenuation of vasoconstriction, with no evidence of alterations in NOS-mediated regulation of blood pressure. PMID: 27534879
  5. MC4R is predominantly expressed in hepatocytes and upregulated during rat liver regeneration after hepatectomy. PMID: 24433867
  6. A synthetic peptide corresponding to cytoplasmic loop 1 of MC4R suppresses basal adenylate cyclase activity and basal level of GppNHp binding of heterotrimeric G proteins produced by THIQ and alpha-MSH in synaptosomal membranes of rat brain. PMID: 26593415
  7. Results suggest that the anti-inflammatory effects of MC4 receptor agonists may not be sufficient to prevent tinnitus. PMID: 25977231
  8. These results suggest that although hindbrain MC4R activity contributes to appetite and heart rate regulation, it does not play a major role in mediating the elevated blood pressue in spontaneously hypertensive rats. PMID: 25668357
  9. Nesfatin-1 suppresses L-type Ca2+ channels via the MC4-R that couples sequentially to the betagamma subunits of Gi/o-protein and the novel PKC theta isoform in adult ventricular myocytes. PMID: 25997563
  10. MC4 receptors play a critical role in stress-induced reinstatement of nicotine seeking, but these receptors may not play a role in the dysphoria associated with acute nicotine withdrawal. PMID: 24612112
  11. The alpha-MSH-MC4R system in the posterior ventral tegmental area might be a part of the neuroadaptive mechanism underlying ethanol addiction. PMID: 24635847
  12. proopiomelanocortin derivatives acting via the central MC4 receptor participate in the resuscitative effects of 8-OH-DPAT PMID: 25371525
  13. These data suggest that increases in arterial pressure with chronic hyperandrogenemia in female rats are due, in part, to activation of the sympathetic nervous system, renal nerves, and MC4R. PMID: 25695289
  14. These results support the hypothesis that endogenous MC4R signaling contributes to the HPA axis response to stress. PMID: 24636506
  15. The data of this study demonstrated that MC4R signaling is not required for weight loss following treatment with an Angiotensin-converting enzyme inhibitor. PMID: 23416175
  16. We showed that the melanocortin-3/4 receptor antagonist SHU 9119 attenuates the food intake-suppressive effect of aminoprocalcitonin. PMID: 23571710
  17. These results indicated that activation of MC4Rs in the right IML elicited tachycardia and one of the sources of melanocortins in the IML is the ARCN. PMID: 23832700
  18. our novel findings show that activation of MC4-Rs in the brainstem modulates gastric activity, which may have physiological relevance for food intake and gastric function PMID: 23946387
  19. Melanocortin-4 receptor signalling in the medial amygdala mediates the behavioral and endocrine response to stress. PMID: 22176700
  20. Results indicate that activation of MC3/4Rs in the paraventricular nucleus increases the sympathetic outflow and blood pressure via the cAMP-protein kinase A pathway. PMID: 22872662
  21. Compared with low-activity rats, high-activity rats show enhanced mRNA expression of MCRs in the brain, specifically of MC3R in the paraventricular nucleus, and MC4R and MC5R in the perifornical lateral hypothalamus. PMID: 22643233
  22. This research suggests that activation of MC4R in PAG after peripheral nerve injury participates in pain facilitation by regulating the glial activation and inflammatory cytokines secretion. PMID: 22889616
  23. Data from heterozygote/homozygote rats for Mc4r mutation suggest that Mc4r has role in development of obesity, but Mc4r does not have a role in weight loss or glucose metabolism/glucose intolerance following bariatric vertical sleeve gastrectomy. PMID: 22535749
  24. Long-Evans rats maintained on chow or a high-fat diet (HFD) for 6 weeks. From a total of 19 genes analyzed, seven genes (ETV5, FTO, GNPDA2, KCTD15, TMEM18, MC4R, and SH2B1) were down-regulated in the hypothalamus of HFD compared to chow-fed rats PMID: 21779089
  25. GLP-1 and leptin cooperatively reduce feeding at least in part via inhibition of AMPK following binding of alpha-MSH to MC4-R. PMID: 22390932
  26. melanocortin 4 receptor activation in astrocytes induces brain-derived neurotrophic factor expression through cyclic AMP-protein kinase A-CAMP response element binding proteins pathway without involving nuclear factor kappa B PMID: 21803120
  27. Protein kinase C-lambda gene knockdown modulates hypothalamic glutathione peroxidase, melanocortin receptor and neuropeptide Y gene expression in amphetamine-treated rats. PMID: 20817751
  28. Distribution of MC4-R is consistent with the proposed roles of MC4-R-positive neurons and provides further information about the circuitry controlling food intake, energy balance and sexual responses in both males and females. PMID: 20884347
  29. data suggest biological role for Mc4r in pancreatic (autonomic) neurons in modulating serum insulin; Mc4r (as well as Mc3r & Mc5r; but not Mc1r) is expressed in pancreas of Zucker rats; Mc4r is expressed in hypothalamus of Zucker rats PMID: 20963574
  30. painful neuropathy resulted in the up-regulation of MC4 receptors in the spinal and peripheral nociceptive pathways. This up-regulation of MC4 receptors promotes the pronociceptive action of their endogenous ligands PMID: 20081244
  31. Data are consistent with the view that energetic and feeding responses are not controlled by regionally divergent MC3/4Rs and can be elicited from multiple, anatomically distributed MC3/4R populations. PMID: 19854868
  32. differential roles for the MC3 and MC4 receptors in TRH release; MC3-R agonism inhibiting and MC4-R agonism stimulating TRH release. PMID: 11963824
  33. The distribution of MC4-R mRNA is consistent with the proposed roles of central melanocortin systems in feeding and autonomic regulation. PMID: 12541307
  34. stimulation of the MC4-R, but not the MC3-R, significantly elevated PRL levels in the fasted rats PMID: 12675910
  35. Activation of melanocortin 4 receptors inhibits fever PMID: 12736185
  36. The expression of the MC4-R in cardiorespiratory, musculoskeletal, and integumentary systems supports functional roles for the MC4-R in addition to its roles in appetite, weight control, and regulation of linear growth. PMID: 12959974
  37. Independent caudal brainstem Mc3r/Mc4r trigger for sympathetically stimulated elevation in brown adipose tissue UCP-1 gene expression. Melanotan-II induced rise in UCP-1 expression can be mediated by caudal brainstem and spinal cord. PMID: 12960080
  38. Anorectic actions of prolactin-releasing peptide are mediated by central CRH receptors but not by melanocortin receptors-3/4. Prolactin-releasing peptide can modify Vo2. PMID: 14512273
  39. Melanocortin MC4 receptor mRNA expression in retina and superior colliculus is decreased in superior colliculus after optic nerve transection, but the expression was unchanged or even increased in the retina. PMID: 14660008
  40. neither MC4-R nor MC3-R is involved in leptin-stimulated or spontaneous growth hormone secretion, or at least that the level of MC4-R involvement in GH secretion is much lower than that in luteinizing hormone and prolactin release regulation. PMID: 14688446
  41. MC4R adaptation in dorsal root ganglia observed in neuropathic rats indicates their important role in presynaptic modulation of activity of the primary afferents in neuropathic pain. PMID: 15026153
  42. MC3/4-R antagonism completely blocked the chronic cardiovascular, satiety, and metabolic effects of leptin, suggesting that the hypothalamic melanocortin system plays an important role in mediating these actions of leptin. PMID: 15123576
  43. The effects of electrical foot shock stress on the melanocortin signaling cascade and the hypothalamus-pituitary-adrenal (HPA) system expression in rats of CRF, POMC, and MC4R. PMID: 15585943
  44. UCP-1, Mc4R and CART gene expression are increased as an immediate consequence of consuming high energy diet, and may be involved in countering hypercaloric intake. PMID: 15720470
  45. alpha-MSH, through central MC4-R can modulate the anxiety-like behavior induced by IL-1beta PMID: 16325304
  46. Metabolic and cardiovascular actions of chronic MC3/4-R activation are preserved in diet-induced obesity, supporting potential role for hypothalamic melanocortin system in obesity hypertension. PMID: 16380516
  47. Alpha-MSH, through MC4R activation, attenuates LPS/IFN-gamma-induced inflammation by decreasing iNOS and COX-2 expression and prevents LPS/IFN-gamma-induced apoptosis of astrocytes by modulating the expression of proteins of Bcl-2 family. PMID: 17595227
  48. melanocortin system contributes to the maintenance of adrenergic tone and elevated arterial pressure in SHR rat even though mRNA levels for POMC and MC4R in the mediobasal hypothalamus were not increased compared to WKY rat PMID: 18285617
  49. MC4R signaling leads mainly to presynaptic modulation of glutamatergic synaptic transmission. Melanocortinergic-induced decrease of food intake may occur via enhancement of vagal afferent satiation signals from gastrointestinal tract. PMID: 18463249
  50. Adeno-associated virus-mediated silencing of MC4R on paraventricular nucleus promotes hyperphagia and obesity in response to the dietary challenge in the adult animal. PMID: 18492813

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain, enriched in the striatum, nucleus accumbens, and periaqueductal gray.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.