Recombinant Rat Melatonin receptor type 1A (Mtnr1a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mtnr1a; Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
CYICHSLKYDRIYSNKNSLCYVFLIWTLTLIAIMPNLQTGTLQYDPRIYSCTFTQSVSSA YTIALVVFHFVVPMIIVTFCYLRIWILVLQVRRRVKPDSKPKLKPQDFRNFVTMFVVFVL FALCWAPLNFIGLIVASDPATMAPRIPEWLFVASYY
Uniprot No.

Target Background

Function
High-affinity receptor for melatonin, likely mediating melatonin's reproductive and circadian effects. Its activity is mediated by pertussis toxin-sensitive G proteins that inhibit adenylate cyclase activity.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
At least in the brain, more precisely in the pars tuberalis and the suprachiasmatic nucleus.

Q&A

What is the molecular structure of rat Melatonin Receptor Type 1A (Mtnr1a)?

Rat Melatonin Receptor Type 1A (MT1) is a G protein-coupled receptor encoded by a gene consisting of two exons. The full-length cDNA contains 1,775 nucleotides, including a 206 bp 5'-UTR, a 1,062 bp open reading frame (ORF), and a 507 bp 3'-UTR . The receptor protein is composed of 353 amino acids with a molecular weight of approximately 39-40 kDa . Rat MT1 shares 84.1% amino acid identity with human MT1 and 92.6% identity with mouse MT1, indicating high evolutionary conservation . The protein exhibits typical G protein-coupled receptor structures, including seven transmembrane domains.

What are the primary signaling pathways associated with rat MT1 receptors?

MT1 melatonin receptors predominantly couple to pertussis toxin-sensitive Gi and pertussis toxin-insensitive Gq/11 G proteins . Activation of MT1 receptors leads to:

  • Inhibition of forskolin-stimulated cyclic adenosine monophosphate (cAMP) production

  • Reduction of protein kinase A signaling

  • Decreased CREB phosphorylation

  • Increased phosphorylation of mitogen-activated protein kinase 1/2 (MAPK1/2)

  • Enhanced phosphorylation of extracellular signal-regulated kinase 1/2 (ERK1/2)

  • Increased potassium conductance through Kir inwardly rectifying channels

These diverse signaling mechanisms allow MT1 receptors to exert multiple physiological effects in various tissues.

What is the tissue distribution pattern of MT1 receptors in rats?

MT1 receptor mRNA exhibits a specific tissue distribution pattern in rats. RT-PCR analysis has demonstrated that MT1 is highly expressed in:

  • Hypothalamus

  • Lung

  • Kidney

  • Adrenal gland

  • Stomach

  • Ovary

Additionally, MT1 is expressed in the mesenteric artery, primarily localized in the vascular smooth muscle layer, as well as in mesenteric artery-associated perivascular adipose tissue (PVAT) . Interestingly, MT1 mRNA expression in male rat GnRH neurons (10.6% positive) shows a sexually dimorphic pattern, with significantly lower expression in female rat GnRH neurons (2.2% positive) .

What are the most reliable methods for detecting rat MT1 receptor expression in tissue samples?

Multiple complementary techniques should be employed for reliable detection of rat MT1 receptor expression:

RT-PCR Analysis:

  • Design primers specific to rat MT1 cDNA sequences (accession number AB377274)

  • Include appropriate positive controls (e.g., rat eye tissue)

  • Use β-actin (ACTB) as an internal control to validate RNA processing

  • Sequence amplicons to confirm specificity

Western Blot Analysis:

  • Use validated antibodies such as rabbit polyclonal anti-MT1 antibody (e.g., amr-031, Alomone Laboratories)

  • Always perform blocking peptide controls to verify antibody specificity

  • MT1 receptor typically appears as bands at approximately 39-40 kDa

Immunofluorescence Microscopy:

  • Fix tissues appropriately (e.g., 4% paraformaldehyde)

  • Include peptide pre-absorption controls to demonstrate specificity

  • Use secondary antibodies with minimal cross-reactivity to rat proteins

  • Employ counterstains to identify cellular structures

Radioligand Binding Assays:

  • 2-[125I]-iodomelatonin is the standard radioligand for MT1 receptor detection

  • Expect Kd values around 73.2 ± 9.0 pM for rat MT1 receptors in recombinant systems

  • Include competition studies with various ligands to confirm pharmacological profile

How can researchers differentiate between MT1 and MT2 receptor expression in rat tissues?

Differentiating between MT1 and MT2 receptor expression requires careful methodological approaches:

Molecular Techniques:

  • Use subtype-specific PCR primers designed to unique regions of each receptor

  • Confirm PCR product identity through sequencing

  • Include positive controls for both receptor subtypes (rat eye tissue expresses both)

Pharmacological Characterization:
Employ selective compounds in competition binding studies with 2-[125I]-iodomelatonin. The rank order of potency for rat MT1 is:

  • 2-iodomelatonin > melatonin > 6-hydroxymelatonin > luzindole > N-acetyl-5-hydroxytryptamine

Tissue Selection Strategy:
Some rat tissues express only MT1 but not MT2, which can serve as natural controls:

  • Mesenteric artery and its associated perivascular adipose tissue express MT1 but not MT2

  • The hypothalamus predominantly expresses MT1 receptors

Functional Discrimination:
MT1 and MT2 receptors can be distinguished by their differential effects on specific signaling pathways:

  • MT1 activation increases potassium conductance

  • MT2 activation decreases cGMP formation and activates protein kinase C in specific tissues

What binding characteristics are expected when working with recombinant rat MT1 receptors?

Recombinant rat MT1 receptors stably expressed in cell lines (such as NIH3T3) demonstrate specific binding characteristics:

Binding Parameters:

  • High-affinity binding of 2-[125I]-iodomelatonin with Kd = 73.2 ± 9.0 pM

  • Similar affinity compared to rat MT2 receptors (Kd = 73.7 ± 2.9 pM)

Pharmacological Profile:
The rank order of potency for inhibition of specific 2-[125I]-iodomelatonin binding is:

  • 2-iodomelatonin

  • Melatonin

  • 6-hydroxymelatonin

  • Luzindole

  • N-acetyl-5-hydroxytryptamine

Experimental Conditions:
For optimal binding studies:

  • Conduct assays at 4°C to minimize receptor degradation

  • Use physiological buffer conditions (pH 7.4)

  • Include protease inhibitors during membrane preparation

  • Allow sufficient incubation time (typically 1-2 hours) to reach equilibrium

How do MT1 receptors in the rat locus coeruleus regulate REM sleep?

MT1 receptors in the rat locus coeruleus (LC) play a crucial role in regulating rapid eye movement (REM) sleep through the following mechanisms:

  • Inhibition of LC-Norepinephrine (NE) Neurons: MT1 receptor activation leads to inhibition of LC-NE neuronal firing activity in a dose-dependent manner .

  • Selective Enhancement of REM Sleep: The first-in-class selective MT1 receptor partial agonist UCM871 has been shown to increase REM sleep duration without affecting non-REM sleep (NREMS) in male rats .

  • Receptor Specificity: The REMS-promoting effects and inhibition of LC-NE neuronal activity by UCM871 are abolished by:

    • MT1 pharmacological antagonism

    • Adeno-associated viral (AAV) vector-mediated knockdown of MT1 receptors specifically in LC-NE neurons

  • Physiological Importance: This represents a novel mechanism for selectively enhancing REM sleep, which is involved in memory consolidation and emotional regulation processes.

This pathway offers significant therapeutic potential for disorders associated with REM sleep impairments, which are often comorbid with psychiatric conditions .

What methodological approaches are most effective for studying MT1-mediated effects in rat vascular tissues?

For investigating MT1-mediated effects in rat vascular tissues, the following methodological approaches are most effective:

Ex Vivo Vessel Function Studies:

  • Isolate rat mesenteric arteries with and without perivascular adipose tissue (PVAT)

  • Mount vessels in myograph systems for isometric tension measurements

  • Apply electrical field stimulation to trigger neurogenic contractions

  • Compare responses in the presence and absence of PVAT to elucidate MT1-mediated effects

Receptor Localization:

  • Employ immunofluorescence microscopy with validated MT1 antibodies

  • Use MT1 blocking peptides as negative controls to confirm specificity

  • Counterstain with markers for smooth muscle, endothelium, and PVAT

  • Analyze colocalization with confocal microscopy

Expression Analysis by Layer:

  • Carefully separate vascular layers (endothelium, smooth muscle, adventitia)

  • Isolate PVAT independently

  • Quantify MT1 mRNA and protein expression in each component

  • Compare relative expression levels between tissue components

Signaling Studies:

  • Monitor changes in cAMP levels after MT1 activation

  • Measure potassium conductance in vascular smooth muscle cells

  • Assess MAPK/ERK phosphorylation status

  • Examine effects on calcium signaling in response to MT1 agonists

What are the key considerations when designing experiments involving recombinant rat MT1 receptors in heterologous expression systems?

When designing experiments with recombinant rat MT1 receptors in heterologous expression systems, researchers should consider:

Expression System Selection:

  • NIH3T3 cells have been successfully used for stable expression of rat MT1 receptors

  • Consider using cell lines of neural origin for neurobiological studies

  • Human embryonic kidney (HEK293) cells offer robust expression and are widely used for GPCR studies

  • CHO cells provide a different cellular background that might influence receptor coupling

Construct Design:

  • Include the complete open reading frame (1,062 bp) for rat MT1

  • Consider adding epitope tags (e.g., FLAG, HA) for detection if antibody specificity is a concern

  • Evaluate the impact of 5'-UTR (206 bp) and 3'-UTR (507 bp) on expression efficiency

  • Use appropriate mammalian expression vectors with strong promoters

Receptor Functionality Verification:

  • Confirm expression by radioligand binding with 2-[125I]-iodomelatonin

  • Verify expected Kd value (~73.2 pM) and pharmacological profile

  • Assess coupling to Gi/Go proteins by measuring inhibition of forskolin-stimulated cAMP production

  • Examine MAPK/ERK phosphorylation responses

Control Conditions:

  • Include vector-only transfected cells as negative controls

  • Consider parallel expression of human MT1 for cross-species comparisons

  • Account for potential variation in receptor expression levels between clones

  • Validate stable cell lines periodically for consistent receptor expression over passages

How do sex differences affect MT1 receptor expression and function in rat tissues?

MT1 receptor expression and function exhibit notable sex differences in rats:

GnRH Neurons:

  • Male rat GnRH neurons show higher MT1 mRNA expression (10.6% positive) compared to female rats (2.2% positive)

  • This sexually dimorphic pattern may contribute to sex-specific regulation of the reproductive axis

  • The difference may be related to differential GnRH secretion patterns between males and females

Mechanism of Sexual Dimorphism:

  • Autocrine GnRH signaling may influence MT1 expression differently in males and females

  • GnRH antagonist (cetrorelix) treatment induces MT1 mRNA expression in immortalized GnRH-secreting neurons (GT1-7 cells)

  • Native GnRH neurons possess a functional self-stimulatory GnRH system with sexually dimorphic characteristics

Functional Implications:

  • Melatonin has been shown to augment GABAA receptor currents in male GnRH neurons, suggesting preferential MT1 expression

  • MT1 and MT2 receptors differentially modulate GABAA receptor functions, with MT1 enhancing and MT2 suppressing these functions

  • These sex differences may contribute to sexually dimorphic regulation of reproduction, circadian rhythms, and other physiological processes

Research Considerations:

  • Studies of MT1 receptor function should account for potential sex differences

  • Both male and female subjects should be included in experimental designs

  • Hormonal status may influence MT1 expression and should be controlled or monitored

What are the unique characteristics of MT1 receptor partial agonists like UCM871 in modulating rat sleep architecture?

MT1 receptor partial agonists like UCM871 demonstrate unique characteristics in modulating rat sleep architecture:

Selective REM Sleep Enhancement:

  • UCM871, a first-in-class selective MT1 receptor partial agonist, selectively increases the duration of REM sleep without affecting non-REM sleep in male rats

  • This effect contrasts with conventional hypnotics that primarily enhance non-REM sleep

Mechanism of Action:

  • UCM871 inhibits locus coeruleus norepinephrine (LC-NE) neuronal firing activity in a dose-dependent manner

  • The LC-NE neurons express MT1 receptors

  • Inhibition of these neurons by MT1 activation triggers REM sleep

Pharmacological Specificity:

  • The effects are mediated specifically through MT1 receptors, as demonstrated by:

    • Abolishment of effects by MT1 pharmacological antagonism

    • Elimination of effects after selective knockdown of MT1 receptors in LC-NE neurons using AAV vectors

Therapeutic Potential:

  • Selective REM sleep enhancement may be beneficial for disorders with REM sleep impairments

  • Potential applications include treatment of psychiatric disorders associated with REM sleep dysfunctions

  • Provides a more targeted approach compared to existing sleep medications

What experimental evidence demonstrates the role of rat MT1 receptors in cardiovascular regulation?

The role of rat MT1 receptors in cardiovascular regulation is supported by several lines of experimental evidence:

Expression Pattern:

  • MT1, but not MT2, is expressed in rat mesenteric artery (MA), primarily in the vascular smooth muscle layer

  • MT1 receptors are also present in mesenteric artery-associated perivascular adipose tissue (PVAT)

  • This selective expression suggests a specific role for MT1 in vascular function

Functional Studies:

  • In isolated superior mesenteric arteries with intact PVAT, neuro-adrenergic contractile responses are significantly reduced compared to arteries with removed PVAT

  • This suggests MT1 receptors in PVAT may influence vascular tone

Receptor Localization:

  • Immunofluorescence microscopy confirms MT1 receptor localization in the smooth muscle layer of mesenteric arteries

  • MT1 immunoreactivity is also detected in PVAT

  • The specificity of this localization is confirmed through blocking peptide controls

Molecular Quantification:

  • Gene expression studies show significantly lower MT1 expression in MA-PVAT compared to MA with PVAT removed (p = 0.034)

  • Protein expression of MT1 is confirmed in both MA and MA-associated PVAT by Western blot

Signaling Mechanisms:

  • MT1 activation in vascular tissues may influence calcium signaling and potassium conductance

  • These effects could modulate vascular tone and blood pressure regulation

  • The coupling to Gi/Go proteins suggests inhibition of adenylate cyclase activity in vascular smooth muscle

What are the major technical challenges in developing specific antibodies for rat MT1 receptors?

Developing specific antibodies for rat MT1 receptors presents several technical challenges:

Low Expression Levels:

  • Native MT1 receptor binding site densities in rat tissues are low or often undetectable

  • This makes it difficult to purify sufficient native protein for antibody production

Structural Considerations:

Cross-Reactivity Issues:

  • High sequence homology between rat MT1 and MT2 receptors (54.7% identity) complicates antibody specificity

  • Even higher homology with mouse MT1 (92.6%) may lead to cross-species reactivity

  • Careful epitope selection is required to ensure MT1 specificity

Validation Challenges:

  • Limited availability of knockout models as negative controls

  • Requirement for multiple validation methods:

    • Western blot with peptide competition controls

    • Immunostaining in tissues with known expression patterns

    • Correlation with mRNA expression data

    • Confirmation in recombinant expression systems

Technical Solutions:

  • Use synthetic peptides corresponding to unique regions of rat MT1 for immunization

  • Employ peptide competition assays as essential controls (e.g., pre-absorbing primary antibody with immunogen peptide)

  • Validate antibodies across multiple detection methods and tissue types

  • Consider alternative detection methods such as receptor autoradiography

What genomic approaches could advance our understanding of rat MT1 receptor function in specific tissues?

Advanced genomic approaches that could enhance our understanding of rat MT1 receptor function include:

Single-Cell RNA Sequencing:

  • Apply to tissues with heterogeneous cell populations (brain, vasculature)

  • Identify specific cell types expressing MT1 receptors

  • Determine co-expression patterns with other receptors and signaling molecules

  • Reveal cell-specific transcriptional responses to MT1 activation

CRISPR-Cas9 Gene Editing:

  • Generate tissue-specific MT1 receptor knockout rat models

  • Create knock-in models with reporter genes or tagged receptors

  • Introduce specific mutations to study structure-function relationships

  • Develop conditional knockout models for temporal control of MT1 expression

Chromatin Immunoprecipitation Sequencing (ChIP-seq):

  • Identify transcription factors regulating MT1 gene expression

  • Map enhancer and promoter regions controlling tissue-specific expression

  • Investigate epigenetic modifications affecting MT1 expression

  • Examine circadian variation in transcriptional regulation

Multi-Cell RT-PCR Approaches:

  • Expand on existing methods used for GnRH neurons

  • Apply to other neuronal populations and tissue types

  • Correlate MT1 expression with functional properties of specific cells

  • Investigate co-expression with downstream signaling molecules

RNA-seq Analysis of MT1-Expressing Tissues:

  • Compare transcriptomes before and after MT1 activation

  • Identify downstream genetic targets of MT1 signaling

  • Analyze tissue-specific signaling pathways

  • Investigate sexually dimorphic gene expression patterns

How might new selective MT1 agonists advance therapeutic applications based on rat model findings?

Emerging selective MT1 agonists like UCM871 could advance therapeutic applications in several ways:

Sleep Disorder Treatments:

  • Selective enhancement of REM sleep without affecting NREMS

  • Potential treatments for psychiatric disorders with REM sleep impairments

  • More targeted approach compared to current hypnotics that primarily increase NREMS

  • Reduced side effects compared to non-selective agents

Neuropsychiatric Applications:

  • MT1 activation may help regulate emotional processes through REM sleep enhancement

  • Memory consolidation, which occurs during REM sleep, could be improved

  • Potential applications in conditions with emotional dysregulation

Cardiovascular Therapeutics:

  • MT1-selective compounds could modulate vascular tone through actions on vascular smooth muscle

  • Effects on perivascular adipose tissue might provide novel approaches to vascular disease

  • Potential for blood pressure regulation without MT2-mediated effects

Drug Development Considerations:

  • Structure-activity relationships from UCM871 (MT1 partial agonist) provide a foundation for developing more selective compounds

  • Receptor subtype selectivity (MT1 vs. MT2) is critical for targeted effects

  • Tissue penetration properties need optimization for specific therapeutic targets (CNS vs. peripheral)

  • Pharmacokinetic/pharmacodynamic relationships should be established in rat models before human translation

Translational Challenges:

  • Species differences between rat and human MT1 receptors (84.1% identity) may affect drug binding

  • Sexually dimorphic expression patterns require consideration in clinical applications

  • Circadian timing of administration may critically influence efficacy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.