Recombinant Rat Mesoderm-specific transcript homolog protein (Mest)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
Mest; Mesoderm-specific transcript homolog protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mest
Target Protein Sequence
MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKTSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHQYSI FEQASIVESLLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPTESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPINPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
Uniprot No.

Target Background

Database Links
Protein Families
AB hydrolase superfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Mest and why is it significant in developmental biology?

Mest (Mesoderm-specific transcript) is an imprinted gene that plays a crucial role in mammalian development, particularly in early organogenesis. It has been identified as a developmentally regulated transcript with high expression during embryonic stages that gradually decreases during later developmental stages. The significance of Mest lies in its exclusive localization to metanephric mesenchyme during early kidney development, suggesting its important role in mesenchymal-to-epithelial transition during organogenesis . Studies show that Mest is implicated in peri-implantation embryogenesis, making it a valuable target for understanding developmental processes .

How does Mest expression change during normal development?

Mest exhibits a dynamic expression pattern during embryonic development. In mouse models, high expression of Mest, with a single ~2.7-kb transcript, is observed at day 13 of gestation, exclusively localized to the metanephric mesenchyme . This expression gradually decreases during later developmental stages and then abruptly decreases in newborn kidneys. In postnatal life, only a very mild expression persists in the glomerular mesangium . The regression in mRNA expression during embryonic renal development appears to be related to methylation of the Mest gene, indicating epigenetic regulation of its temporal expression .

What are the key structural features of the Mest protein?

Based on available research, Mest encodes a putative mesenchymal cell-derived protein. While the search results don't provide detailed structural information, it's known that recombinant Mest protein can be produced by isolating full-length mouse Mest cDNA, subcloning it into an expression vector, and preparing the recombinant protein . The functional Mest protein plays a role in mammalian metanephric development and is subject to imprinting, a process where gene expression depends on parental origin .

How does Mest function in the molecular pathways governing mesenchymal-to-epithelial transition?

Mest appears to be integrally involved in mesenchymal-to-epithelial transition during kidney development. Research indicates that treatment of metanephroi (harvested at day 13 of gestation) with Mest-specific antisense oligodeoxynucleotide results in a dose-dependent decrease in the size of the explants and nephron population . This treatment is associated with a selective decrease in Mest mRNA expression and accelerated apoptosis of the mesenchyme. These findings suggest that Mest plays a role in preventing premature apoptosis of mesenchymal cells during the critical period when they undergo transition to epithelial structures . The molecular mechanisms likely involve complex signaling pathways that regulate cell survival, proliferation, and differentiation during organogenesis.

What is the relationship between Mest expression and glucose-induced dysmorphogenesis in embryonic kidneys?

Experimental evidence shows that high glucose conditions significantly affect Mest expression in developing kidneys. Both Mest and H19 expressions decrease in day 13 metanephric explants treated with high glucose and in kidneys of fetuses obtained from diabetic mothers . This decrease can be observed at both the mRNA level (as demonstrated by competitive RT-PCR, Northern blot, and in situ autoradiographic analyses) and protein level (as assessed by immunofluorescence and immunoprecipitation methods) . This relationship suggests that glucose-induced suppression of imprinted genes like Mest may contribute to the dysmorphogenesis observed in diabetic embryopathy, potentially by disrupting normal mesenchymal-to-epithelial transitions and accelerating inappropriate apoptosis.

How does the epigenetic regulation of Mest impact its developmental function?

Mest is an imprinted gene, meaning its expression is regulated by epigenetic mechanisms including DNA methylation. Research indicates that the regression in Mest mRNA expression during embryonic renal development is related to methylation of the Mest gene . This epigenetic regulation ensures proper temporal expression during development. Any disruptions to this methylation pattern could potentially alter Mest expression and consequently affect developmental processes. The imprinting status of Mest makes it particularly sensitive to environmental factors that might influence epigenetic modifications, such as maternal diabetes, which has been shown to alter Mest expression in embryonic tissues .

What are the most effective methods for detecting Mest expression in tissue samples?

Multiple complementary techniques can be employed to effectively detect Mest expression:

  • Northern Blot Analysis: Useful for detecting and quantifying Mest mRNA transcripts (~2.7 kb) in tissue samples. This method has been successfully used to monitor Mest expression in embryonic kidneys harvested at different gestational days .

  • Competitive RT-PCR: Provides quantitative assessment of Mest mRNA expression and is particularly valuable for comparing expression levels between experimental and control samples .

  • In Situ Tissue Autoradiography: Enables visualization of spatial Mest mRNA expression patterns within tissue sections, which is crucial for understanding its localization to specific cellular compartments within the developing kidney .

  • Immunofluorescence Microscopy: Using antibodies raised against recombinant Mest protein, this technique allows for visualization of Mest protein localization within tissue sections .

  • Immunoprecipitation: Useful for isolating and quantifying Mest protein from tissue lysates, providing information about protein expression levels .

The choice of method depends on the specific research question, with a combination of techniques often providing the most comprehensive characterization of Mest expression.

How can one generate functional recombinant Rat Mest protein for experimental studies?

Based on methodologies described in the research literature, the generation of functional recombinant Rat Mest protein typically involves these key steps:

  • Isolation of Full-Length cDNA: The complete Mest coding sequence should be isolated from rat tissue (commonly embryonic kidney tissue) using RT-PCR with primers designed based on the known Mest sequence .

  • Subcloning into Expression Vector: The isolated cDNA is then subcloned into an appropriate expression vector containing a promoter compatible with the chosen expression system (bacterial, mammalian, or insect cell systems) .

  • Protein Expression: Transform/transfect the recombinant vector into the expression system of choice. For bacterial systems, E. coli strains optimized for protein expression are commonly used.

  • Protein Purification: Recombinant Mest protein can be purified using affinity chromatography, often facilitated by fusion tags incorporated into the expression construct.

  • Validation: The purified protein should be validated for structural integrity and functional activity through various biochemical and biophysical analyses .

This methodological approach has been successfully employed to generate recombinant Mest protein for raising antibodies and conducting functional studies .

What experimental models are most appropriate for studying Mest function in development?

Several experimental models are valuable for investigating Mest function in development:

  • Metanephric Explant Culture: Harvesting metanephroi at day 13 of gestation and culturing them ex vivo allows for manipulation of Mest expression through antisense oligodeoxynucleotides and assessment of developmental outcomes . This model is particularly useful for studying kidney development.

  • Transgenic Mouse Models: Generating mice with modified Mest expression (knockout, conditional knockout, or overexpression) provides insights into its in vivo functions across different developmental contexts.

  • In Vitro Cell Culture Systems: Mesenchymal cell cultures can be used to study Mest's role in cellular differentiation and transition processes.

  • Diabetic Mouse Models: Studying embryos from hyperglycemic mothers helps understand how maternal metabolic conditions affect Mest expression and developmental outcomes .

Each model offers distinct advantages, and the selection should be guided by the specific research questions being addressed. For mechanistic studies of mesenchymal-to-epithelial transition, metanephric explant cultures provide a controlled environment, while transgenic models offer insights into systemic developmental effects.

How should researchers address potential false positive findings in Mest functional studies?

Addressing potential false positive findings in Mest research requires rigorous methodological approaches:

  • Statistical Considerations: Research findings are more likely to be true when studies have higher statistical power, larger effect sizes, and minimal bias. Researchers should employ appropriate statistical tests (e.g., ANOVA for testing null hypotheses) and consider the pre-study probability of true relationships .

  • Experimental Design Strategies:

    • Use confirmatory designs rather than hypothesis-generating experiments when possible

    • Implement adequate controls, including sense oligonucleotide controls when using antisense approaches

    • Employ multiple methodologies to confirm findings (e.g., combine mRNA and protein analyses)

  • Replication and Validation: Independent replication of findings significantly increases confidence. For critical discoveries about Mest function, validation in different experimental systems or by independent research groups is valuable .

  • Critical Evaluation of Effect Sizes: Unusually large effect sizes should be scrutinized carefully, as they may represent experimental bias rather than true biological phenomena .

  • Methodological Transparency: Detailed reporting of experimental methods, including antibody validation for immunological studies of Mest, helps others evaluate and replicate findings .

By implementing these approaches, researchers can minimize false positive findings and build a more reliable knowledge base about Mest function.

What considerations are important when analyzing differential Mest expression across developmental timepoints?

When analyzing Mest expression across developmental timepoints, researchers should consider:

  • Normalization Strategies: Proper normalization to stable reference genes is essential, especially when comparing samples across different developmental stages when global gene expression patterns are changing dramatically.

  • Temporal Resolution: Since Mest expression changes rapidly during development (high at day 13 of gestation and decreasing thereafter), sampling at appropriate intervals is crucial to capture the expression dynamics accurately .

  • Spatial Heterogeneity: Mest expression varies spatially within tissues (e.g., initially in metanephric mesenchyme, later in glomerular mesangium), so whole-tissue analyses may mask important compartment-specific changes .

  • Correlation with Developmental Events: Interpretation of expression changes should be correlated with specific developmental events occurring at each timepoint.

  • Epigenetic Context: Changes in Mest expression should be considered in the context of methylation changes and other epigenetic modifications that regulate imprinted genes .

  • Statistical Analysis of Developmental Trajectories: Appropriate statistical methods for time-series data should be employed when analyzing developmental expression patterns.

This multifaceted approach ensures robust and biologically meaningful interpretation of developmental Mest expression patterns.

How should researchers design experiments to investigate the molecular mechanisms underlying Mest function?

Designing experiments to elucidate Mest's molecular mechanisms requires a multifaceted approach:

  • Loss-of-Function Studies:

    • Antisense oligodeoxynucleotide treatment in metanephric explants has proven effective in studying Mest's role in kidney development

    • CRISPR-Cas9 gene editing can provide more targeted disruption of specific Mest domains

    • Conditional knockout models allow temporal control of Mest inactivation

  • Gain-of-Function Studies:

    • Overexpression of recombinant Mest in relevant cell types

    • Rescue experiments in Mest-depleted systems

  • Interaction Studies:

    • Immunoprecipitation followed by mass spectrometry to identify Mest-interacting proteins

    • Chromatin immunoprecipitation (ChIP) studies if Mest has nuclear functions

  • Signaling Pathway Analysis:

    • Phosphorylation status assessment under various conditions

    • Inhibitor studies to identify pathways that interact with Mest function

  • Spatiotemporal Resolution:

    • Single-cell RNA sequencing to capture cell-type-specific effects

    • Live imaging of tagged Mest to track subcellular localization

Each experimental approach should include appropriate controls and validation steps. For instance, when using antisense oligonucleotides, sense oligonucleotides should be used as controls, and multiple concentrations should be tested to establish dose-dependency .

What factors should be considered when designing studies to examine the relationship between Mest and pathological conditions?

When investigating Mest in pathological contexts, researchers should consider:

  • Disease Relevance: Select pathological models with demonstrated developmental abnormalities, such as diabetic embryopathy models which show altered Mest expression .

  • Timing of Interventions: Since Mest expression is developmentally regulated, the timing of experimental manipulations is critical. Studies should target periods of high Mest expression (e.g., day 13 of gestation in mice) for maximum effect .

  • Physiological Parameters: Control and monitor physiological parameters that might affect Mest expression. For instance, in diabetes models, glucose levels should be carefully monitored and documented .

  • Dose-Response Relationships: Establish dose-response relationships to determine threshold effects, as seen with antisense oligodeoxynucleotide treatments .

  • Multi-Outcome Assessment: Measure multiple outcomes including:

    • Molecular markers (Mest mRNA and protein expression)

    • Cellular responses (apoptosis, proliferation)

    • Morphological parameters (organ size, nephron number)

    • Functional outcomes when possible

  • Translational Considerations: Include experimental designs that bridge between animal models and human pathology when appropriate.

These considerations help ensure robust, reproducible findings with potential clinical relevance.

What are common challenges in detecting Mest protein expression and how can they be overcome?

Researchers frequently encounter these challenges when detecting Mest protein:

  • Low Protein Expression Levels: Mest protein expression may be low in certain developmental stages or tissues.
    Solution: Use more sensitive detection methods such as enhanced chemiluminescence for Western blots or signal amplification techniques for immunohistochemistry .

  • Antibody Specificity: Commercial antibodies may lack specificity for Mest.
    Solution: Generate custom antibodies using recombinant Mest protein as antigen, and thoroughly validate antibody specificity using positive and negative controls .

  • Cross-Reactivity: Antibodies may cross-react with related proteins.
    Solution: Perform antibody pre-absorption studies and include appropriate knockdown controls .

  • Subcellular Localization Changes: Mest protein localization may shift during development or under experimental conditions.
    Solution: Use subcellular fractionation techniques complemented with immunofluorescence to track localization changes .

  • Post-Translational Modifications: Modifications may mask epitopes or alter protein migration.
    Solution: Use multiple antibodies targeting different epitopes and employ phosphatase/deglycosylase treatments when appropriate.

  • Rapid Protein Degradation: Mest protein may have a short half-life.
    Solution: Include protease inhibitors during sample preparation and consider pulse-chase experiments to assess protein stability.

These technical solutions can significantly improve detection of Mest protein in experimental systems.

How can researchers address discrepancies between mRNA and protein expression patterns of Mest?

Discrepancies between Mest mRNA and protein expression are not uncommon and require careful methodological approaches:

  • Temporal Lag: Protein expression often lags behind mRNA expression during development.
    Solution: Design time-course studies with appropriate intervals to capture the relationship between mRNA and subsequent protein expression .

  • Spatial Discrepancies: Intriguingly, research shows that while Mest mRNA is expressed in the mesenchyme, the protein has been detected in metanephric epithelial elements and ureteric bud branches.
    Solution: Perform parallel in situ hybridization and immunohistochemistry on serial sections to directly compare spatial patterns .

  • Post-Transcriptional Regulation: MicroRNAs or RNA-binding proteins may regulate Mest translation.
    Solution: Investigate the presence of miRNA binding sites in Mest transcripts and assess the expression of candidate regulatory molecules.

  • Protein Trafficking: Mest protein might be synthesized in one cell type but transported to another.
    Solution: Perform pulse-chase experiments combined with co-culture systems to track protein movement between cell types.

  • Methodological Differences: Different sensitivities of mRNA versus protein detection methods may contribute to apparent discrepancies.
    Solution: Calibrate detection methods using standards and employ multiple complementary techniques for both mRNA and protein detection .

Understanding these discrepancies can provide valuable insights into the post-transcriptional regulation and function of Mest during development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.