Recombinant Rat Metallophosphoesterase 1 (Mppe1)

What is Metallophosphoesterase 1 (Mppe1) and what are its fundamental properties?

Metallophosphoesterase 1 (Mppe1), also known as Post-GPI attachment to proteins factor 5 (Pgap5), is a protein that belongs to the metallophosphoesterase enzyme family. In rats (Rattus norvegicus), Mppe1 is encoded by the Mppe1 gene with the UniProt accession number B1WC86 . The full-length protein consists of 394 amino acids with a specific sequence beginning with "MALVRWGLRRQNFHLLRRRRVLLLKLTVVVISVLLFCEYFIYYLVLFRCHWPEVKMPARG..." . Functionally, Mppe1 has enzymatic activity (EC= 3.1.-.-) and is involved in post-translational modifications of proteins, specifically in the processing of glycosylphosphatidylinositol (GPI)-anchored proteins.

How should Recombinant Rat Mppe1 be stored and handled in laboratory settings?

For optimal stability and activity, Recombinant Rat Mppe1 should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein . For extended storage periods, conservation at -80°C is recommended . To prevent protein degradation, researchers should avoid repeated freezing and thawing cycles. When actively working with the protein, aliquots can be stored at 4°C for up to one week . It's advisable to prepare working aliquots upon first thawing to minimize exposure to detrimental temperature fluctuations.

What expression systems are used for producing Recombinant Rat Mppe1?

While specific expression systems for Rat Mppe1 aren't explicitly detailed in the provided search results, the general methodology for recombinant protein production typically involves cloning the target gene sequence into an expression vector for transfection into a host system. For similar proteins like α3 (IV) NC1, researchers have used HEK293 cells as an expression system . When producing Recombinant Rat Mppe1, the expression region typically spans amino acids 1-394 of the full-length protein . Tag types (such as FLAG, His, or GST) are determined during the production process based on experimental requirements and downstream applications .

What quantification methods are appropriate for Recombinant Rat Mppe1?

Appropriate quantification methods for Recombinant Rat Mppe1 include:

• Spectrophotometric measurement at 280 nm for protein concentration determination, similar to methods used for other recombinant proteins .

• SDS-PAGE analysis for purity assessment and approximate molecular weight confirmation.

• Western blotting using specific antibodies (such as those targeting Mppe1 like ab177092 from Abcam) for identity verification .

• If the recombinant protein contains a tag (e.g., FLAG), column chromatography with the appropriate affinity gel can be used for both purification and quantitative analysis .

What is the significance of Mppe1 mutations in hepatocellular carcinoma (HCC)?

Research has identified a significant association between Mppe1 mutations and hepatocellular carcinoma (HCC). Specifically, a missense mutation on chr18_11897016 in the Mppe1 gene was found to be the most frequent mutation (16.5%) in primary and recurrent HCC tissues, with a higher frequency in recurrent HCC compared to primary HCC or benign liver tumor tissues . Statistical analysis demonstrated that this Mppe1 mutation was significantly associated with:

• HCC recurrence (P = .003)

• TNM stage (P = .002)

• Child–Pugh classification (P = .039)

Moreover, the mutation was identified as an independent risk factor for HCC recurrence (HR = 1.969; 95%CI = 1.043–3.714, P = .037) . The postoperative tumor recurrence rates for HCC patients with the Mppe1 mutation were substantially higher (53%, 69%, and 69% at 1, 2, and 3 years, respectively) compared to those without the mutation (28%, 45%, and 56% at 1, 2, and 3 years, respectively) .

How does Mppe1 expression influence cancer cell behavior?

Mppe1 expression significantly impacts cancer cell behavior, as demonstrated through knockdown experiments in HCC cell lines. When Mppe1 expression was reduced in HuH-7 and HepG2 cells:

• Cell proliferation was significantly inhibited (P < .001)

• Cell cycle progression was disrupted with:

  • Increased proportion of cells in G0/G1 phase

  • Reduced proportion of cells in S phase

• Apoptosis was enhanced:

  • Increased percentage of early and late apoptotic cells

  • Increased cleavage of PARP, a hallmark of apoptosis

• Cell invasion and migration capabilities were significantly reduced

• Epithelial-mesenchymal transition (EMT) was affected:

  • E-cadherin expression was significantly upregulated (P = .002)

  • N-cadherin expression was significantly downregulated (P < .001)

These findings collectively suggest that Mppe1 plays a crucial role in promoting cancer cell proliferation, survival, and metastatic potential.

What is the relationship between Mppe1 expression and tumor development in vivo?

In vivo studies using xenograft tumor models in nude mice have demonstrated that transcriptional silencing of Mppe1 in HepG2 cells significantly reduced tumor growth parameters compared to control groups . Specifically:

• Tumor weight was significantly reduced

• Tumor volume was significantly reduced (P = .049)

These findings complement the in vitro observations and provide compelling evidence that Mppe1 plays a crucial role in tumor development and progression in a living organism. The mechanism appears to involve Mppe1's influence on cell proliferation, apoptosis resistance, and potentially other tumorigenic processes like angiogenesis and immune evasion, though the latter mechanisms require further investigation.

What is the proposed mechanism of action for Mppe1 in cellular functions?

While the complete mechanism of Mppe1 action remains under investigation, several observations provide insight into its functional role:

• The mutation site (p. E83G) associated with HCC is located close to putative active sites (D77, H79, D119), suggesting the mutation may influence Mppe1's enzymatic activity .

• Mppe1 appears to regulate the cell cycle transition from G0/G1 to S phase, indicating involvement in cell cycle checkpoint control mechanisms .

• Mppe1 influences epithelial-mesenchymal transition (EMT), a process critical for cancer cell invasion and metastasis, by regulating expression of EMT markers such as E-cadherin and N-cadherin .

• As a metallophosphoesterase enzyme, Mppe1 likely catalyzes the hydrolysis of phosphoester bonds in substrates that may include signaling molecules or structural proteins involved in cellular processes such as proliferation, survival, and motility.

What are effective techniques for Mppe1 knockdown in cellular models?

For effective Mppe1 knockdown in cellular models, researchers have successfully employed RNA interference (RNAi) techniques using short hairpin RNAs (shRNAs). The methodology includes:

• Design of target-specific shRNA sequences:

  • Using online tools (e.g., http://rnaidesigner.thermofisher.com/) to design shRNA sequences targeting human Mppe1 mRNA

  • Including scrambled sequences with no homology to the human genome as negative controls

• Vector construction and delivery:

  • Cloning shRNA sequences into lentiviral vectors (e.g., pLV-H1-Puro-GFP)

  • Confirmation of successful cloning by Sanger sequencing

  • Production of shRNA-expressing recombinant lentiviruses

  • Stable transfection of target cells (e.g., HepG2 and HuH-7)

• Validation of knockdown efficiency:

  • Western blotting using specific antibodies for Mppe1 (e.g., ab177092, Abcam, USA)

  • Quantitative PCR for mRNA expression analysis

This approach has been demonstrated to effectively reduce Mppe1 expression and enable subsequent functional studies.

What assays are recommended for evaluating the functional effects of Mppe1 manipulation?

Based on published research, the following assays are recommended for evaluating the functional effects of Mppe1 manipulation:

• Cell proliferation assays:

  • MTT or similar colorimetric assays

  • Cell counting

  • BrdU incorporation for DNA synthesis assessment

• Cell cycle analysis:

  • Flow cytometry with propidium iodide staining

  • Expression analysis of cell cycle regulators by Western blot

• Apoptosis assays:

  • Flow cytometry with Annexin V/PI staining to detect early and late apoptotic cells

  • Western blotting for apoptotic markers (e.g., cleaved PARP)

• Cell migration and invasion assays:

  • Transwell migration assays

  • Matrigel invasion assays

  • Wound healing/scratch assays

• EMT marker analysis:

  • Western blotting for E-cadherin and N-cadherin

  • Immunofluorescence for cellular localization

• In vivo tumor growth:

  • Xenograft models in immunodeficient mice

  • Measurement of tumor volume and weight over time

These complementary approaches provide a comprehensive assessment of Mppe1's functional roles in cellular processes relevant to cancer biology.

How can researchers verify the specificity of observed phenotypes in Mppe1 studies?

To ensure the specificity of observed phenotypes in Mppe1 studies, researchers should implement several validation strategies:

• Multiple knockdown approaches:

  • Use at least two different shRNA sequences targeting different regions of Mppe1 mRNA to rule out off-target effects

  • Compare with non-targeting control shRNAs

• Rescue experiments:

  • Re-express shRNA-resistant Mppe1 variants to restore the wild-type phenotype

  • Include both wild-type and mutant (e.g., E83G) versions to assess mutation-specific effects

• Dose-dependent effects:

  • Establish correlation between the degree of Mppe1 knockdown and the magnitude of phenotypic changes

• Multiple cell lines:

  • Confirm findings across different cell types (e.g., HuH-7 and HepG2)

  • Consider normal hepatocyte cell lines as controls

• In vivo validation:

  • Extend in vitro findings to animal models (e.g., xenograft models in nude mice)

  • Compare with appropriate controls using the same genetic background

• Clinical correlation:

  • Analyze the relationship between Mppe1 expression/mutation status and patient outcomes

These approaches collectively strengthen the evidence for a direct causal relationship between Mppe1 and the observed phenotypes.

How should researchers interpret Mppe1 mutation data in clinical samples?

When interpreting Mppe1 mutation data in clinical samples, researchers should consider:

• Mutation frequency and distribution:

  • The Mppe1 missense mutation on chr18_11897016 occurs in 16.5% of HCC tissues, with higher frequency in recurrent HCC than primary HCC

  • Analyze mutation patterns across different patient subgroups

• Statistical associations:

  • Use appropriate statistical methods to assess associations with clinical parameters

  • For categorical variables (e.g., TNM stage, Child–Pugh classification), Chi-square tests are appropriate

  • For survival analysis, Kaplan-Meier curves and log-rank tests can evaluate association with outcomes like recurrence

• Multivariate analysis:

  • Use Cox proportional hazards model to identify independent risk factors

  • The Mppe1 mutation has been identified as an independent risk factor for HCC recurrence (HR = 1.969; 95%CI = 1.043–3.714, P = .037)

• Comparative analysis between datasets:

  • Compare mutation data with expression data from public databases like GEO and TCGA

  • Consider potential discrepancies between datasets due to sample size limitations or methodological differences

The table below summarizes key statistical findings regarding Mppe1 mutation:

What are the challenges in comparing Mppe1 expression data across different studies?

Researchers face several challenges when comparing Mppe1 expression data across different studies:

• Methodological variations:

  • Different techniques for measuring expression (qPCR, microarray, RNA-seq)

  • Varying sample preparation methods and quality control standards

  • Different normalization strategies and reference genes

• Sample heterogeneity:

  • Tumor tissue heterogeneity and varying proportions of tumor cells

  • Differences in patient populations and disease stages

  • Variations in control tissue selection (adjacent non-tumor vs. healthy tissue)

• Database limitations:

  • Inconsistencies between public databases (e.g., GEO vs. TCGA)

  • Limited sample sizes for non-tumor tissues in some databases

  • As noted in one study, "the difference in MPPE1 expression in HCC tumor samples and adjacent nontumor tissues was not significant [in TCGA data], possibly because of the limited number of nontumor samples included in the TCGA analysis"

• Interpretation complexities:

  • Distinguishing between correlation and causation

  • Accounting for confounding factors

  • Integrating mutation and expression data

How can researchers design experiments to establish causal relationships for Mppe1?

To establish causal relationships between Mppe1 and observed phenotypes, researchers should design experiments that:

• Employ genetic manipulation approaches:

  • Knockdown studies using shRNA or CRISPR-Cas9 to reduce Mppe1 expression

  • Overexpression studies to assess gain-of-function effects

  • Site-directed mutagenesis to investigate specific mutations (e.g., E83G)

• Include appropriate controls:

  • Non-targeting shRNA or empty vector controls

  • Rescue experiments with wild-type Mppe1

• Demonstrate mechanistic pathways:

  • Identify direct molecular targets of Mppe1 enzymatic activity

  • Map signaling pathways affected by Mppe1 modulation

  • Use inhibitors of specific pathway components to validate mechanisms

• Establish temporal relationships:

  • Time-course experiments to determine sequence of events

  • Inducible expression/knockdown systems

• Validate in multiple models:

  • Different cell lines (e.g., HuH-7 and HepG2)

  • Animal models (e.g., xenograft models in nude mice)

  • Patient-derived organoids or samples

• Quantify dose-response relationships:

  • Titrate levels of Mppe1 expression/knockdown

  • Correlate with magnitude of phenotypic changes

These experimental approaches collectively strengthen the evidence for causality and help elucidate the mechanisms by which Mppe1 influences cellular processes and disease progression.

What are promising therapeutic strategies targeting Mppe1 in disease contexts?

Based on current understanding of Mppe1's role in disease processes, particularly in hepatocellular carcinoma, several promising therapeutic strategies can be explored:

• Small molecule inhibitors:

  • Targeting the enzymatic activity of Mppe1

  • As noted in research, "enzymes are generally accepted as ideal drug targets, and developing drugs (such as small molecular inhibitors) that target enzyme activity is warranted"

  • Focus on the active sites (D77, H79, D119) and the mutation site (p. E83G)

• RNA interference-based therapies:

  • shRNA or siRNA delivery systems to reduce Mppe1 expression in tumors

  • Building on successful in vitro and in vivo knockdown strategies

• Combination therapies:

  • Pairing Mppe1 inhibition with standard chemotherapeutics

  • Targeting multiple nodes in Mppe1-related signaling pathways

• Biomarker development:

  • Using Mppe1 mutation status as a prognostic marker for HCC recurrence

  • Developing companion diagnostics for Mppe1-targeted therapies

• Immunotherapeutic approaches:

  • Exploring Mppe1 as a tumor-associated antigen

  • Developing antibody-based therapies or immune checkpoint modulators

Future research should assess the efficacy, specificity, and safety profiles of these approaches, with particular attention to potential off-target effects and resistance mechanisms.

What are key unanswered questions about Mppe1 function and regulation?

Despite progress in understanding Mppe1's role in disease, several critical questions remain unanswered:

• Substrate specificity and enzymatic mechanism:

  • What are the natural substrates of Mppe1?

  • How does the E83G mutation affect substrate binding or catalytic activity?

  • What is the three-dimensional structure of Mppe1 and how does it relate to function?

• Regulatory mechanisms:

  • How is Mppe1 expression regulated at the transcriptional and post-transcriptional levels?

  • What signaling pathways modulate Mppe1 activity?

  • Are there post-translational modifications that affect Mppe1 function?

• Cellular roles beyond cancer:

  • What is Mppe1's normal physiological function in healthy tissues?

  • Does Mppe1 play roles in other diseases besides HCC?

  • How does Mppe1 interact with the broader cellular proteome?

• Mutation effects:

  • What is the functional impact of the E83G mutation on enzymatic activity?

  • Are there other mutations in Mppe1 associated with disease?

  • How do mutations affect protein stability, localization, or interactions?

• Translational questions:

  • Can Mppe1 serve as a biomarker for early detection or monitoring of HCC?

  • What patient populations would benefit most from Mppe1-targeted therapies?

  • How can Mppe1 inhibitors be optimally delivered to tumor tissues?

Addressing these questions will require multidisciplinary approaches spanning biochemistry, structural biology, cell biology, and clinical research.

How might technological advances accelerate Mppe1 research?

Emerging technologies offer promising avenues to accelerate research into Mppe1 function and therapeutic applications:

• CRISPR-Cas9 gene editing:

  • Creating precise mutations to study structure-function relationships

  • Generating knockout models for in-depth phenotypic analysis

  • High-throughput screening of genetic interactions

• Single-cell technologies:

  • Single-cell RNA-seq to understand heterogeneity in Mppe1 expression

  • Single-cell proteomics to map Mppe1 interaction networks

  • Spatial transcriptomics to visualize Mppe1 expression patterns in tissues

• Structural biology advances:

  • Cryo-electron microscopy for high-resolution protein structure determination

  • Molecular dynamics simulations to study enzyme-substrate interactions

  • Structure-based drug design for developing specific inhibitors

• Organoid and patient-derived xenograft models:

  • More physiologically relevant systems for studying Mppe1 function

  • Platforms for personalized medicine approaches

  • Testing therapeutic strategies in models that better recapitulate human disease

• Artificial intelligence and machine learning:

  • Predicting Mppe1 interactions and functions

  • Accelerating drug discovery targeting Mppe1

  • Integrating multi-omics data to understand Mppe1 in system-wide contexts

These technological advances can help overcome current limitations in Mppe1 research and potentially expedite the development of targeted therapies.