Recombinant Rat Metalloreductase STEAP3 (Steap3)

Shipped with Ice Packs
In Stock

Description

Overview of STEAP3

Metalloreductase STEAP3 (Six-Transmembrane Epithelial Antigen of the Prostate 3) is a transmembrane protein critical for iron and copper homeostasis. It functions as a ferric-chelate reductase, converting Fe³⁺ to Fe²⁺ and Cu²⁺ to Cu¹⁺, facilitating cellular uptake of these metals . While research on recombinant rat STEAP3 is limited in publicly available literature, insights can be extrapolated from studies on human and murine homologs, given structural and functional conservation across species .

Iron and Copper Homeostasis

  • Iron Reduction: STEAP3 reduces Fe³⁺ in transferrin-bound iron, enabling Fe²⁺ transport via DMT1 into the cytosol . Knockout models exhibit microcytic anemia due to impaired erythroid iron uptake .

  • Copper Reduction: Converts extracellular Cu²⁺ to Cu¹⁺ for cellular assimilation, impacting cuproenzyme synthesis .

Inflammatory and Apoptotic Regulation

  • STEAP3 modulates TLR4-mediated inflammatory responses by regulating cytosolic iron availability. Deficiency disrupts interferon-β and chemokine production .

  • Acts downstream of p53 to interface apoptosis and cell cycle progression, with implications in cancer and ischemia-reperfusion injury .

Research Applications of Recombinant STEAP3

Recombinant STEAP3 is utilized in:

  • Iron Metabolism Studies: Elucidating transferrin-dependent iron uptake mechanisms in erythroid cells .

  • Therapeutic Development: Targeting STEAP3 in prostate cancer, hepatocellular carcinoma, and inflammatory disorders .

  • Exosome Research: STEAP3 facilitates exosomal protein secretion (e.g., TCTP), influencing tumor-microenvironment interactions .

Hepatic Ischemia-Reperfusion Injury

  • Mechanism: STEAP3 exacerbates liver damage by activating TAK1-dependent JNK/p38 pathways. Knockout mice show reduced necrosis and inflammatory infiltration .

  • Therapeutic Implication: Targeting hepatocyte STEAP3 mitigates ischemia-reperfusion injury .

Cancer Progression

  • Colorectal Cancer (CRC): STEAP3 stabilizes β-catenin via Wnt signaling, promoting tumor growth .

  • Hepatocellular Carcinoma (HCC): Nuclear STEAP3 enhances EGFR-STAT3 signaling, driving proliferation and stemness .

Recombinant Protein Production

While rat-specific protocols are not detailed in the provided sources, human and murine STEAP3 production frameworks suggest:

ParameterHuman STEAP3 Example Extrapolated for Rat
Expression SystemHEK-293 cells or E. coliLikely similar (HEK-293 for glycosylation)
TagHis-tag for purificationHis- or FLAG-tag
Purity>90% (SDS-PAGE validated)Comparable with affinity chromatography
Storage-80°C in Tris/PBS buffer with 6% trehaloseSimilar cryoprotectants recommended

Challenges and Future Directions

  • Species-Specific Variations: Rat STEAP3 may exhibit unique structural motifs affecting metal-binding affinity or substrate specificity.

  • Therapeutic Targeting: Small-molecule inhibitors or CRISPR-based knockdown require validation in rat disease models .

References (Key Findings)

  1. Iron Homeostasis: STEAP3 mediates erythroid iron uptake via NADPH-dependent reduction .

  2. Inflammation: Steap3-KO mice show impaired TLR4 signaling and cytokine production .

  3. Cancer: STEAP3 promotes CRC via Wnt/β-catenin and HCC via EGFR-STAT3 pathways .

  4. Ischemia-Reperfusion: STEAP3 inhibition reduces hepatic injury through TAK1/JNK modulation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Steap3; Metalloreductase STEAP3; Six-transmembrane epithelial antigen of prostate 3; pHyde
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-488
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSGEMDKPLISRRLVDSDGSLAEVPKEAPKVGILGSGDFARSLATRLVGSGFSVVVGSRN PKRTAGLFPSLAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLADQLAGKILVDVSNPTEK ERLQHRQSNAEYLASLFPACTVVKAFNVISAWALQAGPRDGNRQVLICGDQLEAKHTVSE MARAMGFTPLDMGSLASAREVEAIPLRLLPSWKVPTLLALGLFVCFYAYNFIRDVLQPYI RKDENKFYKMPLSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ HRKQIGLLSFFFAMLHALYSFCLPLRRSHRYDLVNLAVKQVLANKSRLWVEEEVWRMEIY LSLGVLALGMLSLLAVTSIPSIANSLNWKEFSFVQSTLGFVALMLSTMHTLTYGWTRAFE ENHYKFYLPPTFTLTLLLPCVIILAKGLFLLPCLSHRLTKIRRGWERDGAVKFMLPAGHT QGEKTSHV
Uniprot No.

Target Background

Function
Endosomal ferrireductase is essential for efficient transferrin-dependent iron uptake in erythroid cells. It plays a role in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+). Additionally, it mediates the reduction of Cu(2+) to Cu(1+), suggesting its involvement in copper homeostasis. NADP(+) acts as an acceptor in this process. This protein is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCTP. It may also play a role downstream of p53/TP53, connecting apoptosis and cell cycle progression.
Database Links
Protein Families
STEAP family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.

Q&A

What is the primary molecular function of STEAP3?

STEAP3 functions primarily as an integral membrane protein that acts as a NADPH-dependent ferric-chelate reductase. It uses NADPH from one side of the membrane to reduce Fe(3+) chelate bound on the other side, mediating sequential transmembrane electron transfer from NADPH to FAD and onto heme, ultimately reducing Fe(3+) to Fe(2+) . Beyond iron reduction, STEAP3 can also reduce Cu(2+) to Cu(1+), demonstrating versatility in metal ion reduction capabilities . In erythroid cells, STEAP3 mediates efficient transferrin-dependent iron uptake, which is essential for proper red blood cell development and function .

How does STEAP3 contribute to cellular iron homeostasis?

STEAP3 serves as the major ferric reductase in developing erythrocytes and plays a crucial role in regulating iron homeostasis . Its importance is demonstrated in knockout models where Steap3 null mice display severe microcytic anemia due to reduced ferric reductase activity and abnormal erythroid maturation . The protein's reductase activity enables the conversion of Fe(3+) to Fe(2+), making iron available for cellular processes including ribonucleotide reductase function and mitochondrial respiratory chain activities . Through this mechanism, STEAP3 may influence cellular fate toward proliferation or apoptosis by regulating intracellular iron content .

What alternative names and structural features characterize STEAP3?

STEAP3 is also known by several alternative names including TSAP6, Dudulin-2, Tumor suppressor-activated pathway protein 6, pHyde, hTSAP6, and hpHyde . As suggested by its primary name (Six-transmembrane epithelial antigen of the prostate 3), the protein contains six transmembrane domains characteristic of the STEAP family. This structural arrangement facilitates its function in transmembrane electron transfer, allowing it to use cytosolic NADPH as an electron donor to reduce extracellular or vesicular iron .

How does STEAP3 contribute to hepatic ischemia/reperfusion injury?

STEAP3 has been identified as a critical mediator of hepatic ischemia/reperfusion (I/R) injury. Research shows that Steap3 expression is significantly up-regulated in liver tissue from mice subjected to hepatic I/R surgery and in primary hepatocytes challenged with hypoxia/reoxygenation insult . Experimental evidence using global Steap3 knockout (Steap3-KO) mice demonstrates that Steap3 deficiency protects against hepatic I/R injury, as shown by:

  • Smaller necrotic areas in liver sections

  • Lower serum transaminase levels

  • Decreased apoptosis rates

  • Reduced inflammatory cell infiltration

Mechanistically, Steap3 deficiency inhibits transforming growth factor-β–activated kinase 1 (TAK1) activation and downstream c-Jun N-terminal kinase (JNK) and p38 signaling pathways during hepatic I/R injury . This suggests that STEAP3 functions by regulating inflammatory responses and apoptosis through TAK1-dependent activation of the JNK/p38 pathways .

What role does STEAP3 play in hepatocellular carcinoma?

STEAP3 exhibits significant oncogenic properties in hepatocellular carcinoma (HCC). Studies have found that STEAP3 is aberrantly overexpressed in the nuclei of HCC cells . In clinical HCC tissues, high expression levels of nuclear STEAP3 positively correlate with tumor differentiation and poor prognosis, establishing it as an independent prognostic factor for HCC patients .

At the cellular level, nuclear expression of STEAP3 promotes HCC cell proliferation through multiple mechanisms:

  • Enhancing stemness phenotype:

    • Increased sphere-propagating capacity

    • Elevated expression of pluripotency transcription factors (NANOG and OCT4)

  • Accelerating cell cycle progression:

    • Faster passage through G1 checkpoint

    • Upregulation of G1 Cyclins (Cyclin D1 and Cyclin D3) and CDKs (CDK4 and CDK6)

  • Modulating cell survival pathways:

    • Upregulation of inflammatory factors (IL-8, IL-18, HSP72)

    • Increased expression of HIF1α and anti-apoptotic proteins (BCL-2, MCL1)

    • Downregulation of pro-apoptotic proteins (BAK1, PUMA)

How is STEAP3 implicated in triple-negative breast cancer?

This finding has been validated through multiple approaches:

  • Bioinformatic analysis of public datasets (TCGA, GEO)

  • Western immunoblotting in breast cancer cell lines (MDA-MB-468, MDA-MB-231) compared to control (MCF-10A)

  • Analysis of TNBC patient tissue samples versus adjacent normal tissue

STEAP3 has been identified as part of a ferroptosis-related gene (FRG) model that can accurately forecast the prognosis of TNBC patients, laying groundwork for potential targeted therapy approaches .

What methods are effective for detecting and measuring STEAP3 expression?

Several complementary techniques have proven effective for detecting and quantifying STEAP3 expression in research settings:

Protein Detection Methods:

  • Western Blotting - Using specific antibodies such as rabbit recombinant monoclonal STEAP3 antibody (e.g., EPR9812)

  • Immunohistochemistry - Particularly useful for determining cellular localization (nuclear vs. cytoplasmic)

Gene Expression Analysis:

  • RT-qPCR - For quantifying mRNA levels in cell lines and tissue samples

  • RNA-Seq - For comprehensive transcriptomic analysis and identification of co-regulated genes

Detection MethodApplicationsAdvantagesConsiderations
Western BlottingProtein level quantificationSemi-quantitative, detects specific isoformsRequires quality antibodies
ImmunohistochemistryTissue localization studiesMaintains tissue architecture, shows cellular localizationFixation can affect epitope recognition
RT-qPCRmRNA expression analysisHighly sensitive, quantitativeDoes not reflect post-transcriptional regulation
RNA-SeqGlobal expression patternsComprehensive, detects novel transcriptsRequires sophisticated bioinformatic analysis

How can STEAP3 gene function be manipulated in experimental models?

Researchers have employed several strategies to manipulate STEAP3 expression and function in experimental models:

Genetic Knockout Models:

  • Global Steap3 knockout mice (Steap3-KO) - These models have been instrumental in revealing STEAP3's role in hepatic I/R injury and iron metabolism

  • Hepatocyte-specific Steap3 transgenic mice (Steap3-HTG) - These models allow for tissue-specific overexpression studies

In Vitro Manipulation:

  • Plasmid-based overexpression - Used to create stable cell lines with enhanced STEAP3 expression (e.g., PLC/PRF/5-STEAP3)

  • siRNA or shRNA-mediated knockdown - For targeted reduction of STEAP3 expression

  • CRISPR/Cas9 gene editing - For precise modification of the STEAP3 gene

Pathway Intervention:
Specific inhibitors targeting STEAP3-regulated pathways can be employed to dissect molecular mechanisms:

  • STAT3 inhibitor (C188-9)

  • STAT6 inhibitor (AS1517499)

What cell lines and models are optimal for STEAP3 functional studies?

Several established cell lines and model systems have been successfully used to study STEAP3 function:

Cell Lines:

  • Hepatocellular carcinoma lines:

    • PLC/PRF/5 - Used for STEAP3 overexpression studies

    • Additional HCC lines for comparative analyses

  • Breast cancer cell lines:

    • MDA-MB-231, BT-549, BT-468, MDA-MB-468 - TNBC cell lines with elevated STEAP3 expression

    • MCF-10A - Normal breast epithelial cells (control)

Primary Cell Cultures:

  • Primary hepatocytes - For studying hypoxia/reoxygenation injury models

Animal Models:

  • Mouse models of hepatic I/R injury - Created through surgical intervention

  • Xenograft models - For studying STEAP3's role in tumor progression

How does subcellular localization affect STEAP3 function?

STEAP3's function varies significantly depending on its subcellular localization, with important implications for both normal physiology and disease states:

Membrane-Associated STEAP3:
The canonical role of STEAP3 as a transmembrane protein involves ferric reductase activity, facilitating iron uptake in developing erythrocytes . At the plasma membrane, it mediates the reduction of Fe(3+) to Fe(2+), enabling iron transport across the membrane . Additionally, membrane-associated STEAP3 participates in exosome secretion by facilitating the release of proteins such as TCTP .

Nuclear STEAP3:
Research has revealed a non-canonical nuclear localization of STEAP3 with distinct functions:

  • In HCC cells, nuclear STEAP3 promotes cell proliferation by enhancing stemness and cell cycle progression

  • Nuclear STEAP3 upregulates the expression and nuclear trafficking of EGFR, participating in a positive feedback loop that regulates EGFR-mediated STAT3 transactivity

  • High nuclear STEAP3 expression correlates with tumor differentiation and poor prognosis in HCC patients

The mechanisms governing STEAP3's nuclear translocation and its specific nuclear functions represent an important frontier in understanding its role in cancer progression.

What signaling pathways are regulated by STEAP3 in pathological contexts?

STEAP3 regulates multiple signaling pathways with context-dependent outcomes:

In Hepatic I/R Injury:
STEAP3 mediates injury through TAK1-dependent activation of downstream JNK and p38 signaling . Specifically:

  • Steap3 deficiency inhibits TAK1 activation

  • This inhibition reduces downstream JNK and p38 pathway activation

  • The modulation of these pathways reduces inflammatory responses and apoptosis

In Cancer Progression:
STEAP3 activates distinct signaling axes that promote cell proliferation:

  • RAC1-ERK-STAT3 signaling axis

  • RAC1-JNK-STAT6 signaling axis

These pathways have differential impacts on cancer cell behavior:

  • STAT3 inhibition causes massive cell death under starvation-induced stress in STEAP3-overexpressing cells

  • STAT6 inhibition has a less pronounced effect on cell survival

  • STAT3 plays a more critical role in STEAP3-induced cell proliferation

Additionally, STEAP3 establishes a positive feedback loop through EGFR signaling by:

  • Upregulating EGFR expression

  • Enhancing EGFR nuclear trafficking

  • Modulating EGFR-mediated STAT3 transactivity

What is the relationship between STEAP3 and ferroptosis in cancer?

Emerging evidence identifies STEAP3 as a ferroptosis-related gene (FRG) with significant implications for cancer progression, particularly in triple-negative breast cancer:

This relationship between STEAP3 and ferroptosis represents a promising area for therapeutic exploration, potentially offering new strategies for targeting cancer cells through modulation of iron-dependent cell death pathways.

How might STEAP3 function as a therapeutic target in different disease contexts?

Based on current research, STEAP3 presents several opportunities as a therapeutic target with context-dependent strategies:

For Hepatic I/R Injury:
Targeting STEAP3 could protect against liver damage during transplantation or other procedures involving ischemia/reperfusion:

  • Inhibition of STEAP3 expression or function may reduce inflammatory responses and apoptosis

  • Blocking the STEAP3-TAK1-JNK/p38 pathway could preserve hepatocyte viability

  • Targeting hepatocyte STEAP3 specifically may provide a promising approach to protect the liver against I/R injury

For Cancer Therapy:
STEAP3 targeting offers potential in both hepatocellular carcinoma and triple-negative breast cancer:

  • In HCC:

    • Disrupting nuclear localization of STEAP3 could impair cancer cell proliferation

    • Targeting the STEAP3-RAC1-ERK-STAT3 axis might reduce stemness and slow cell cycle progression

    • Inhibiting the STEAP3-EGFR positive feedback loop could suppress tumor growth

  • In TNBC:

    • STEAP3 could serve as both a prognostic biomarker and therapeutic target

    • Strategies exploiting the connection between STEAP3 and ferroptosis might sensitize cancer cells to cell death

    • Combination approaches targeting STEAP3 alongside conventional therapies could improve outcomes

Development of specific STEAP3 inhibitors, localization-disruptive agents, or downstream pathway modulators represents promising research directions for translating STEAP3 biology into clinical applications.

What are best practices for isolating and characterizing recombinant STEAP3 protein?

Successful isolation and characterization of recombinant STEAP3 protein requires attention to several methodological considerations:

Expression Systems:

  • Mammalian expression systems (HEK293, CHO cells) are preferred for maintaining proper post-translational modifications

  • Insect cell systems (Sf9, High Five™) may be used for higher yield of membrane proteins

  • Bacterial systems are less optimal due to STEAP3's transmembrane nature and need for proper folding

Purification Strategies:

  • Affinity chromatography using N- or C-terminal tags (His, GST, FLAG)

  • Size exclusion chromatography for further purification

  • Ion exchange chromatography for removing contaminants

Characterization Methods:

  • Western blotting with specific antibodies (e.g., rabbit monoclonal EPR9812)

  • Mass spectrometry for protein identification and post-translational modification analysis

  • Enzymatic activity assays measuring ferric reductase function

  • Circular dichroism for secondary structure analysis

Activity Assessment:

  • NADPH consumption assays

  • Fe(3+) reduction measurements

  • Transferrin-dependent iron uptake assays in cell-based systems

How can researchers effectively study STEAP3's dual functions in different subcellular compartments?

Investigating STEAP3's compartment-specific functions requires specialized techniques:

Subcellular Fractionation:

  • Differential centrifugation to separate membrane, cytosolic, and nuclear fractions

  • Density gradient centrifugation for further purification of specific organelles

  • Western blotting of fractions with compartment-specific markers to confirm separation quality

Localization-Specific Constructs:

  • Creating STEAP3 constructs with altered localization signals:

    • Membrane-targeted STEAP3 (enhanced transmembrane domains)

    • Nuclear localization signal (NLS)-tagged STEAP3

    • Nuclear export signal (NES)-tagged STEAP3

Live Cell Imaging:

  • Fluorescent protein fusion constructs for real-time tracking of STEAP3 localization

  • Photoactivatable or photoconvertible tags for studying protein trafficking between compartments

  • FRET-based approaches for examining protein-protein interactions in specific compartments

Function-Specific Assays:

  • Membrane STEAP3: Iron reduction and transport assays

  • Nuclear STEAP3: Transcriptional reporter assays, chromatin immunoprecipitation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.