Recombinant Rat Methyltransferase-like protein 23 (Mettl23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Mettl23; Probable methyltransferase-like protein 23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mettl23
Target Protein Sequence
MAGARLFRFRDEPGPGADPTVLEVRVPQVLHVQYGMYVWPCAVVLAQYLWFHRRVLPGKA VLEIGAGVSLPGILAAKCGAKVTLSDSPELPHCLDICWQSCQMNNLPQVQIVGLTWGHIS KDTLSLPPQDIILGSDVFFEPEDFESILATVYFLMQKNPKVQFWSTYQVRSADWSLEGLL YKWDMRCVHIPLESFDADKEDIAESTLPGRHTIEMLIISFAKDSS
Uniprot No.

Target Background

Function
Probable methyltransferase.
Database Links
Protein Families
Methyltransferase superfamily, METTL23 family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is METTL23 and What Are Its Known Functions in Cellular Processes?

METTL23 (methyltransferase like 23) functions primarily as a histone arginine methyltransferase that dimethylates histone H3 at 'Arg-17', forming asymmetric dimethylarginine (H3R17me2a), which activates transcription through chromatin remodeling . Beyond this epigenetic role, METTL23 serves as a transcriptional regulator through its interaction with GABPA (GA-binding protein transcription factor, alpha subunit) .

This interaction affects the expression of GABP target genes including:

GABP Target GeneFunctionEffect of METTL23
THPO (thrombopoietin)Regulates platelet productionOverexpression of METTL23 increases transcriptional activity
ATP5B (ATP synthase, β polypeptide)Mitochondrial ATP productionKnockdown of METTL23 decreases expression

Research indicates that METTL23 and GABPA have additive effects on transcriptional regulation, demonstrating that METTL23 positively modulates GABP function through direct protein-protein interaction .

What Structural Features Define METTL23 and How Do They Relate to Its Function?

Structural analysis of METTL23 reveals features typical of SAM-dependent methyltransferases:

The full-length protein (isoform 1) consists of 190 amino acids, while isoform 2 contains 123 amino acids . 3D modeling indicates METTL23 adopts a fold characteristic of methyltransferases with:

  • A central β-sheet core structure essential for catalytic activity

  • A SAM/SAH-binding pocket formed by approximately 25 residues, with ~50% completely conserved among related methyltransferases

  • Critical functional motifs including motif 1, post 1, motif 2, and DXXY sequences that are essential for seven-β-strand methyltransferase function

Disruption of these structural elements through truncation or mutation leads to loss of proper folding and abolished methyltransferase activity. For example, disease-associated mutations that truncate the protein disrupt the catalytic domain and alter cellular localization . These structural insights are crucial for understanding how mutations in METTL23 lead to pathological conditions and for designing functional studies.

How Should Researchers Design Experimental Approaches to Express and Purify Recombinant Rat METTL23?

Expression and purification of recombinant rat METTL23 presents unique challenges requiring specific methodological considerations:

Expression systems and conditions:

  • Mammalian cells preserve native folding and post-translational modifications

  • E. coli BL21 cells can produce good yields but often result in inclusion bodies

  • Co-expression with chaperones (e.g., GroEL) significantly improves solubility

Purification strategy:

  • Use affinity tags (His-tag) for initial purification

  • Apply affinity chromatography followed by size exclusion chromatography

  • Be aware that METTL23 may co-elute with chaperone proteins, indicating tight binding

Buffer and storage optimization:

  • Store in PBS buffer supplemented with 50% glycerol in Tris-based buffer

  • For short-term use: maintain at 4°C (up to one week)

  • For extended storage: keep at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles

Quality control parameters:

  • Verify purity using SDS-PAGE (aim for >80% purity)

  • Confirm identity via Western blotting with anti-METTL23 antibodies

  • Test endotoxin levels (should be < 1.0 EU per μg of protein)

The tight binding observed between METTL23 and chaperones (e.g., GroEL) is particularly noteworthy and consistent with evidence suggesting METTL23 may interact with molecular chaperones like heat shock proteins, potentially as substrates for methylation .

What Approaches Can Be Used to Assess the Methyltransferase Activity of METTL23?

Measuring the methyltransferase activity of METTL23 requires specialized assays that detect methyl group transfer to specific substrates:

In vitro methylation assays:

  • Purify recombinant METTL23 (with FLAG-His6 or similar tags)

  • Use histone H3.1 as a substrate

  • Include S-adenosyl-methionine (SAM) as the methyl donor

  • Detect methylation using antibodies specific for H3R17me2a

  • Compare activity between wild-type and mutant METTL23 variants

Cell-based methylation detection:

  • Transfect cells with METTL23 expression vectors

  • Extract histones and perform Western blotting with anti-H3R17me2a antibodies

  • Compare methylation levels in cells expressing wild-type versus mutant METTL23

Reporter gene assays for functional assessment:

  • Use luciferase reporter constructs containing GABP-regulated promoters (e.g., THPO)

  • Co-transfect with METTL23 expression vectors

  • Measure transcriptional activity as an indirect readout of METTL23 function

Essential controls:

  • No enzyme control

  • No SAM control

  • Heat-inactivated enzyme control

  • Known methyltransferase control

These methodologies allow researchers to quantify METTL23 activity and determine how mutations or experimental conditions affect its function.

How Do Disease-Associated Mutations in METTL23 Affect Protein Function?

METTL23 mutations have been linked to intellectual disability (ID) and normal tension glaucoma (NTG). These mutations provide insight into critical functional domains:

Mutation TypeExamplesMolecular ConsequencesDisease Association
Frameshiftc.169_172delCACT (p.His57Valfs*11)Premature truncation, disruption of catalytic domain Autosomal recessive ID
Nonsensec.397C>T (p.Arg133*)Truncated protein (position 1-132), lacking catalytic domain Autosomal recessive ID
Splice sitec.A83GExon 2 skipping, aberrant splicing products, reduced expression Normal tension glaucoma
Missensec.310T>C (p.Phe104Leu)Likely affects protein folding or substrate binding Intellectual disability

Functional studies demonstrate that these mutations lead to:

  • Altered subcellular localization (reduced nuclear localization)

  • Impaired histone H3R17 methylation

  • Disrupted interaction with GABPA and reduced regulation of target genes

  • Decreased protein stability and expression levels

In animal models, METTL23 mutations recapitulate disease phenotypes:

  • Mettl23 knockout and knockin mice develop glaucoma without elevated intraocular pressure

  • Reduced METTL23 expression in retinal ganglion cells of these mice correlates with progressive retinal degeneration

These findings highlight the importance of METTL23's methyltransferase activity and protein-protein interactions for normal neurological function and ocular health.

How Can Researchers Effectively Study the Interaction Between METTL23 and GABPA?

The functional interaction between METTL23 and GABPA is critical for transcriptional regulation. Multiple complementary approaches can be used to investigate this interaction:

Protein-protein interaction detection:

  • Yeast two-hybrid screening:

    • GABPA has been successfully used as bait to identify METTL23 as an interacting partner

    • Multiple positive colonies with METTL23 cDNAs confirm specificity of interaction

  • Co-immunoprecipitation:

    • Overexpress tagged METTL23 in appropriate cell lines (HEK293T, N2A)

    • Immunoprecipitate using tag-specific antibodies

    • Detect endogenous GABPA in immunoprecipitates via Western blotting

    • Chemical cross-linkers can stabilize transient interactions

Functional validation approaches:

  • Luciferase reporter assays:

    • Use promoters of known GABP target genes (e.g., THPO)

    • Compare effects of METTL23 overexpression, GABPA overexpression, and co-expression

    • Quantify additive effects to determine functional interaction

  • Gene expression analysis:

    • Knockdown METTL23 using siRNA

    • Measure expression of GABP target genes (e.g., ATP5B)

    • Quantify changes using RT-qPCR or RNA-seq

Results from these experiments indicate that overexpression of METTL23 significantly increases transcription at GABP-regulated promoters, while METTL23 knockdown reduces expression of GABP target genes without affecting GABPA levels themselves .

What Are the Best Approaches for Generating and Characterizing METTL23 Animal Models?

CRISPR/Cas9 technology has successfully generated METTL23 animal models that recapitulate human disease phenotypes:

Knockout model generation:

  • Target strategy: deletion mutation (e.g., c.221_224del) resulting in frameshift

  • Validation: confirm by DNA sequencing and absence of METTL23 protein in homozygous mutants

Knockin model strategies:

  • Create heterozygous (Mettl23+/G) and homozygous (Mettl23G/G) mice carrying specific mutations

  • Validate mutations through DNA sequencing and RT-PCR analysis of splicing patterns

  • Confirm protein expression changes via Western blotting

Phenotypic characterization protocol:

  • General assessment:

    • Track weight, gross appearance, and litter size

    • Monitor intraocular pressure (IOP)

  • Glaucoma-specific evaluation:

    • Measure ganglion cell complex (GCC) thickness using optical coherence tomography (OCT)

    • Assess retinal function using electroretinography (ERG)

    • Evaluate progressive retinal degeneration over time

  • Neurological assessment:

    • Perform behavioral tests relevant to intellectual disability

    • Examine brain structure via MRI or histology

Molecular characterization:

  • Analyze H3R17me2a levels in relevant tissues

  • Assess expression of GABP target genes

  • Perform RNA-seq to identify global transcriptional changes

METTL23 mouse models have shown that both knockout and disease-specific knockin mutations recapitulate glaucoma phenotypes without elevated IOP, validating their relevance to human disease .

How Should Researchers Investigate the Tissue-Specific Functions of METTL23?

METTL23 shows tissue-specific expression patterns and functions, particularly in the brain and eye. These can be studied through:

Expression analysis:

  • RNA-seq data indicates METTL23 is expressed at low-to-moderate levels in the developing human brain

  • This expression level is comparable to other genes implicated in intellectual disability, such as CC2D1A

  • Quantitative RT-PCR across tissues shows ubiquitous but low-level expression in multiple tissues

Cell type-specific investigations:

  • Confocal microscopy shows that METTL23 localizes to both cytoplasm and nucleus in multiple cell types (HEK293T, HeLa, N2A)

  • Cell-specific effects are observed (e.g., methylation activity detectable in some cell lines but not others)

  • iPSCs from patients with METTL23 mutations can be differentiated into relevant cell types

Brain-specific functional studies:

  • In mice, Mettl23 mutations affect brain development

  • Human patients show specific brain abnormalities including white matter myelination delay and thin splenium of the corpus callosum

Ocular tissues:

  • METTL23 is expressed in retinal ganglion cells (RGCs) in both murine and macaque retinas

  • Reduced expression correlates with RGC loss in glaucoma models

When designing tissue-specific studies, researchers should consider:

  • Using cell types relevant to the diseases associated with METTL23

  • Employing conditional knockout approaches to target specific tissues

  • Correlating animal model findings with human patient phenotypes

What Are the Most Promising Approaches for Identifying Novel METTL23 Substrates?

Beyond histone H3, METTL23 likely methylates other proteins. Several complementary approaches can identify these substrates:

Candidate-based approaches:

  • Investigate proteins known to interact with METTL23

  • Focus on molecular chaperones, which show strong association with METTL23

  • Test heat shock proteins, particularly HSP60 (human homolog of GroEL)

Unbiased screening methods:

  • Protein microarray screening:

    • Use purified recombinant METTL23 and labeled SAM

    • Screen arrays of potential substrate proteins

    • Validate hits using targeted methylation assays

  • Proximity-based identification:

    • Express METTL23 fused to BioID or APEX2

    • Identify proteins in close proximity through biotinylation

    • Verify candidates through in vitro methylation assays

  • Methylome analysis:

    • Compare arginine methylation patterns in wild-type vs. METTL23-deficient cells

    • Enrich methylated proteins using specific antibodies

    • Identify differentially methylated proteins by mass spectrometry

Functional validation strategies:

  • Demonstrate direct methylation by METTL23 in vitro

  • Map methylation sites using mass spectrometry

  • Determine functional consequences of methylation on substrate activity

The interaction of METTL23 with chaperones is particularly intriguing, as recent research suggests that a group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity .

How Can Seemingly Contradictory Results in METTL23 Research Be Reconciled?

Resolving contradictions in METTL23 literature requires systematic analysis of experimental variables:

Cell type-specific effects:

  • H3R17me2a methylation is detectable in some cell lines but not others after METTL23 expression

  • This may reflect cell-specific cofactors or regulatory mechanisms

  • For example, H3R17me2a was undetectable in transfected 661W cells but present in other cell types

Isoform-specific considerations:

  • METTL23 has two protein isoforms (190 and 123 amino acids)

  • Studies may examine different isoforms without clear specification

  • Comparing expression patterns and functional properties of each isoform is essential

Mutation-specific effects:

  • Different mutations may affect METTL23 function in distinct ways:

    • Some disrupt protein folding

    • Others affect subcellular localization

    • Some specifically impair catalytic activity

  • Patient phenotypes vary in severity, suggesting genotype-phenotype correlations

Methodological differences:

  • Overexpression vs. knockdown approaches may yield different results

  • In vitro vs. cellular assays may not always correlate

  • Different antibodies or detection methods may have varying sensitivities

When encountering contradictory findings, researchers should:

  • Directly compare experimental conditions

  • Validate findings using multiple complementary approaches

  • Consider biological context when interpreting results

  • Explicitly acknowledge limitations and potential confounding factors

What Experimental Approaches Are Most Effective for Studying the Epigenetic Functions of METTL23?

METTL23's role as a histone arginine methyltransferase requires specialized approaches to study its epigenetic functions:

Histone methylation analysis:

  • Western blotting with H3R17me2a-specific antibodies

    • Compare methylation levels in wild-type vs. METTL23-deficient cells

    • Examine effects of METTL23 overexpression on global H3R17me2a levels

  • In vitro histone methylation assays

    • Use recombinant histones as substrates

    • Include SAM as methyl donor

    • Compare wild-type and mutant METTL23 activity

Genome-wide methylation mapping:

  • ChIP-seq using H3R17me2a antibodies

    • Map genome-wide distribution of H3R17me2a marks

    • Compare patterns between control and METTL23-deficient cells

    • Correlate with transcriptionally active regions

  • Integrative analysis

    • Combine ChIP-seq with RNA-seq data

    • Identify genes regulated by METTL23-dependent H3R17 methylation

    • Determine if GABPA binding sites correlate with H3R17me2a marks

Functional consequences:

  • Gene expression analysis

    • Perform RNA-seq in METTL23-deficient vs. control cells

    • Focus on genes known to be regulated by arginine methylation

    • Validate key targets by RT-qPCR

  • Chromatin accessibility

    • Use ATAC-seq to determine if METTL23 affects chromatin structure

    • Compare accessibility at H3R17me2a-marked regions

Importantly, the recent discovery that METTL23 dimethylates H3R17 in the retina and is required for transcription highlights its direct epigenetic role, which may be tissue-specific and context-dependent .

What Are the Critical Controls Needed in METTL23 Functional Studies?

Robust experimental design for METTL23 studies requires careful consideration of appropriate controls:

For protein expression studies:

  • Empty vector control

  • Inactive METTL23 mutant (e.g., catalytic domain mutation)

  • Different METTL23 isoforms

  • Tagged vs. untagged versions (to assess tag interference)

For methyltransferase activity assays:

  • No enzyme control

  • No SAM (methyl donor) control

  • Heat-inactivated enzyme control

  • Known methyltransferase control

  • Unmethylatable substrate control (e.g., H3R17K mutant)

For protein-protein interaction studies:

  • METTL23 truncation mutants

  • Known GABPA interactors as positive controls

  • Non-interacting proteins as negative controls

  • Reciprocal co-immunoprecipitation

For genetic studies:

  • Heterozygous models (Mettl23+/−) for dose-dependent effects

  • Different mutation types (null vs. specific patient mutations)

  • Age-matched controls for developmental phenotypes

  • Background strain-matched controls for mouse studies

For cell-based assays:

  • Multiple cell types to account for context-dependent functions

  • Rescue experiments with wild-type METTL23

  • Dose-response experiments

  • Time-course analyses for dynamic processes

The choice of controls should be guided by the specific experimental question and approach. For example, studies examining splicing effects of the c.A83G mutation included sequencing of multiple splicing products from both patient and control iPSCs to fully characterize the aberrant splicing patterns .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.