Recombinant Rat Microsomal glutathione S-transferase 1 (Mgst1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Mgst1; Gst12; Microsomal glutathione S-transferase 1; Microsomal GST-1; Microsomal GST-I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-155
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Mgst1
Target Protein Sequence
ADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAKK FLRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAY LTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL
Uniprot No.

Target Background

Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Gene References Into Functions
  1. Since Mgst1expression was reported to decline with age, our results could represent a putative adaptive process during aging. It could also be an early mechanism protecting neuronal cells against some neurodegenerative insults PMID: 24419913
  2. Two doxorubicin derivatives/prodrugs (DNS-DOX; MNS-DOX) are substrates for MGST1; neoplasm drug resistance can be overcome in cell lines over-expressing recombinant MGST1. PMID: 21851097
  3. These results indicate that mitochondrial membrane glutathione transferase in the outer mitochondrial membrane is activated by gallic acid, which may contribute to mitochondrial permeability transition pore formation. PMID: 19111564
  4. Increased expression of miR-34a and miR-93 in rat liver during aging, and their impact on the expression of Mgst1 and Sirt1. PMID: 21216258
  5. measured mass of the homotrimer is 53 kDa, allowing for the mass of three MGST molecules in complex with one glutathione molecule. PMID: 14726533
  6. Solvent kinetic isotope effect measurements demonstrated a 2-fold decrease in the rate constant (k(2)) for thiolate formation and k(cat) (in the reaction with 1-chloro-2,4-dinitrobenzene) for both unactivated and activated MGST1 PMID: 15236595
  7. activation of microsomal glutathione S-transferase 1 by peroxynitrite is mediated by nitration of tyrosine residue 92 PMID: 16314419
  8. These results demonstrate that MGST1 is not a ready candidate for S-nitrosylation in the cellular content, despite its susceptibility to S-nitrosylation under broken cell conditions. PMID: 16899233
  9. Results indicate that mtMGST1 is activated through mixed disulfide bond formation that contributes to cytochrome c release from mitochondria through the MPT pore. PMID: 18634816

Show More

Hide All

Database Links
Protein Families
MAPEG family
Subcellular Location
Microsome. Mitochondrion outer membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highest in the liver, followed by kidney and testis and much lower in seminal vesicles, spleen, lung and brain.

Q&A

What is the basic structure of rat Microsomal Glutathione S-Transferase 1?

Rat MGST1 functions as a homotrimer, with each functional unit centered on the crystallographic three-fold axes. The protein consists of 155 amino acids (residues Met8~Leu155), with a predicted molecular mass of 46.7 kDa (although accurate SDS-PAGE determination under reducing conditions shows it to be approximately 47 kDa) . Electron crystallography of two-dimensional crystals has revealed that the model comprises 123 of the 155 amino acid residues, two structured phospholipid molecules, two aliphatic chains, and one glutathione (GSH) molecule per subunit . The glutathione substrate binds in an extended conformation at the interface between two subunits of the trimer, creating three active sites per trimeric complex .

How does MGST1 associate with cellular membranes?

MGST1 exhibits a polytopic membrane association model. Topology experiments using E. coli spheroplasts have demonstrated that MGST1 has specific membrane orientation: lysine-4 is directed toward the outside, whereas lysine-41 faces the inside of the E. coli inner membrane . This orientation is "inside-out" in E. coli spheroplasts compared to liver microsomes, which has important implications for experimental design . The enzyme is firmly embedded in the membrane and cannot be removed by washing or other procedures that release loosely bound material from membranes . Various analytical methods including EDTA stripping, protease protection assay, and extraction with alkaline Na₂CO₃ have confirmed that MGST1 is associated with the inner microsomal membrane .

What are the primary functional roles of MGST1 in biological systems?

MGST1 serves several critical functions in cellular defense mechanisms:

  • Conjugation of electrophilic compounds with glutathione, particularly detoxification of xenobiotics

  • Protection against oxidative stress through its glutathione peroxidase activity

  • Metabolism of drugs, especially those with electrophilic properties

  • Protection of biological membranes against oxidative damage

  • Conjugation of specific substrates such as 1-chloro-2,4-dinitrobenzene with glutathione

  • Detoxification of 4-hydroxynonenal through conjugation with GSH

The enzyme exhibits significant selenium-independent glutathione peroxidase activity toward physiologically relevant fatty acid hydroperoxides, including linoleic and arachidonic acid hydroperoxides, as well as phosphatidylcholine hydroperoxide, though it shows minimal activity with H₂O₂ .

What is the tissue distribution pattern of MGST1 in mammals?

The tissue distribution of MGST1 varies significantly between human and rat tissues. In humans, Northern blot analysis normalized against glyceraldehyde-3-phosphate dehydrogenase or actin expression has revealed the following relative expression levels :

TissueRelative Expression (%)
Liver and pancreas100
Kidney, prostate, colon30-40
Heart, brain, lung, testis, ovary, small intestine10-20
Placenta, skeletal muscle, spleen, thymus, peripheral blood leucocytes1-10

In rat tissues, the expression pattern shows a more pronounced liver predominance, with extrahepatic tissues showing only 0.2-10% of liver expression levels. The highest extrahepatic expression in rats occurs in adrenal, uterus, ovary, and stomach . Human fetal tissues also show liver-enriched expression, with lung and kidney having lower levels (10-20%), while fetal brain and heart show no detectable transcripts .

How is MGST1 gene expression regulated at the transcriptional level?

Human MGST1 gene expression involves multiple alternative first exons. Expressed sequence tag (EST) characterization has identified four alternate mRNA transcripts with different 5'-ends, representing four alternate noncoding exons 1 . One predominant exon gives rise to mature mRNA in most human tissues examined, showing a tissue distribution similar to that obtained using the reading frame as probe . This predominant exon appears to differ from the major first exon expressed in rodent tissues, suggesting species-specific regulatory mechanisms .

Unlike cytoplasmic glutathione S-transferases, microsomal MGST1 activity is not significantly affected by classical inducers of drug-metabolizing systems such as phenobarbital, methylcholanthrene, and trans-stilbene oxide . This differential response to inducers clearly distinguishes the regulatory mechanisms of microsomal MGST1 from those governing cytoplasmic GSTs .

What is the catalytic mechanism of MGST1?

MGST1 catalyzes the conjugation of glutathione (GSH) with various electrophilic compounds, a reaction that requires the formation of a strongly nucleophilic GSH thiolate . The catalytic mechanism involves:

  • Binding of GSH at the interface between two subunits of the trimeric enzyme

  • Stabilization of the GSH thiolate by specific amino acid residues, particularly Arginine 130

  • Nucleophilic attack of the activated GSH on electrophilic substrates

  • Formation of a conjugate that is subsequently released from the enzyme

Site-directed mutagenesis studies have demonstrated that Arginine 130 is critical for catalytic activity - mutation of this residue to alanine results in complete loss of enzymatic function . This supports the role of Arginine 130 in stabilizing the GSH thiolate required for the conjugation reaction .

For substrates forming Meisenheimer complexes (such as trinitrobenzene), electron diffraction studies have revealed that side chain movements open a cavity that defines the second substrate site .

How can MGST1 activity be modulated experimentally?

MGST1 activity can be significantly modulated through several experimental approaches:

  • N-ethylmaleimide (NEM) treatment: MGST1 can be activated up to eight-fold by treatment with N-ethylmaleimide . This activation affects not only the catalytic rate but also the apparent Km of the enzyme for both glutathione and substrates like 1-chloro-2,4-dinitrobenzene .

  • Sulfhydryl group modification: The possibility of activating MGST1 through attack on a sulfhydryl group may represent an important physiological response to certain xenobiotics .

  • Expression system selection: When expressed in E. coli, MGST1 maintains enzymatic activity but adopts an inside-out orientation compared to liver microsomes, which may affect substrate accessibility and catalytic efficiency .

  • S-nitrosylation: Although in vitro activation of purified rat MGST1 by S-nitrosylation has been reported, studies have failed to detect S-nitrosylated MGST1 in rat liver microsomes treated with S-nitrosoglutathione (GSNO) or in endotoxin-challenged rats, suggesting this modification may not be physiologically relevant in certain conditions .

What are the optimal conditions for recombinant expression of rat MGST1?

Recombinant rat MGST1 can be successfully expressed in Escherichia coli as an enzymatically active protein . Key considerations for optimal expression include:

  • Expression system: Prokaryotic expression in E. coli has been demonstrated to yield active enzyme .

  • Subcellular localization: The recombinant protein does not form inclusion bodies but is recovered in the membrane fraction, reflecting its natural membrane association .

  • Purification approach: The enzyme can be expressed with N-terminal His and GST tags to facilitate purification while maintaining activity .

  • Buffer conditions: For storage and reconstitution, 10mM PBS (pH 7.4) is recommended, with addition of stabilizers such as 0.01% SKL and 5% Trehalose for lyophilized preparations .

  • Storage conditions: To maintain stability, aliquoting and storing at -80°C for long-term storage (12 months) is recommended, while avoiding repeated freeze/thaw cycles .

What techniques can be used to study MGST1 membrane topology?

Several complementary approaches have been employed to investigate MGST1 membrane topology:

  • Proteolytic cleavage analysis: Comparing proteolytic cleavage products from intact and permeabilized spheroplasts can reveal the orientation of specific residues with respect to the membrane .

  • Site-directed mutagenesis: Modifying specific residues and assessing their accessibility to membrane-impermeable reagents can map topology .

  • Electron crystallography: This technique has been used to determine atomic models of rat MGST1 in a lipid environment, revealing detailed structural information .

  • Protease protection assay: This method helps determine which portions of the protein are accessible on the cytoplasmic surface of the endoplasmic reticulum .

  • EDTA stripping and alkaline Na₂CO₃ extraction: These approaches help distinguish between peripheral and integral membrane proteins, confirming the nature of MGST1's membrane association .

How does MGST1 contribute to cellular defense against oxidative stress?

MGST1 plays a multifaceted role in protecting cells against oxidative stress through several mechanisms:

  • Glutathione peroxidase activity: MGST1 exhibits significant selenium-independent glutathione peroxidase activity toward physiologically relevant hydroperoxides, including fatty acid hydroperoxides (linoleic and arachidonic acid hydroperoxides) and phosphatidylcholine hydroperoxide . This activity enables the reduction of potentially harmful lipid hydroperoxides that could otherwise propagate oxidative damage in cellular membranes.

  • Detoxification of reactive aldehydes: MGST1 catalyzes the conjugation of 4-hydroxynonenal (4-HNE) with glutathione . 4-HNE is a highly reactive aldehyde generated during lipid peroxidation that can damage proteins and DNA, making its detoxification critical for cellular survival during oxidative stress.

  • Membrane protection: The localization of MGST1 to the endoplasmic reticulum membrane strategically positions it to protect membrane integrity against oxidative damage . This is particularly important given that membrane lipids are highly susceptible to peroxidation during oxidative stress.

  • Drug resistance in tumors: Emerging data indicate that MGST1 is overexpressed in certain tumors, potentially contributing to resistance against cytostatic drugs through detoxification mechanisms .

These protective functions may explain why MGST1 is conserved across species and expressed in most mammalian cell types, suggesting it performs essential functions vital to cellular survival .

What is the relationship between MGST1 and cancer drug resistance?

Recent research suggests MGST1 may play a significant role in cancer drug resistance:

  • Overexpression in tumors: Emerging data show that MGST1 is overexpressed in certain tumor types, potentially as an adaptive response to increased oxidative stress or exposure to xenobiotics .

  • Protection against cytostatic drugs: MGST1 has been implicated in protecting cancer cells from cytostatic drugs through detoxification mechanisms . Many chemotherapeutic agents either are electrophilic or generate reactive oxygen species as part of their mechanism of action, making them potential substrates or indirect targets for MGST1.

  • Potential therapeutic target: The association between MGST1 expression and drug resistance suggests it could be a target for adjuvant therapies aimed at enhancing the efficacy of existing chemotherapeutic agents .

Research in this area is still developing, but the connection between MGST1 and cancer drug resistance represents an important frontier in understanding how tumors evade therapeutic intervention through detoxification mechanisms.

What are common challenges in working with recombinant MGST1 and their solutions?

Researchers working with recombinant MGST1 may encounter several technical challenges:

  • Maintaining membrane association: As an integral membrane protein, MGST1 requires appropriate detergents or lipid environments to maintain its native conformation and activity. Solution: Use mild detergents such as octyl glucoside or phospholipid vesicles to solubilize or reconstitute the enzyme .

  • Expression system orientation: The inside-out orientation of MGST1 in E. coli compared to liver microsomes can affect experimental design and interpretation . Solution: Consider the altered topology when designing experiments, particularly those involving substrate accessibility or membrane-impermeable reagents.

  • Activity measurement: The dual activities of MGST1 (glutathione transferase and peroxidase) require different assay systems. Solution: For transferase activity, use substrates like 1-chloro-2,4-dinitrobenzene; for peroxidase activity, use fatty acid hydroperoxides while monitoring glutathione oxidation .

  • Protein stability: Recombinant MGST1 may exhibit reduced stability compared to the native enzyme. Solution: Store reconstituted protein at 2-8°C for short-term use (one month) or aliquot and store at -80°C for long-term storage (12 months), while avoiding repeated freeze/thaw cycles .

  • Activation state: The enzyme's activity can vary significantly depending on activation state (e.g., after N-ethylmaleimide treatment) . Solution: Standardize activation protocols and include appropriate controls to account for this variability in experimental design.

How can researchers distinguish between MGST1 and cytosolic glutathione S-transferases in experimental systems?

Distinguishing between microsomal MGST1 and cytosolic glutathione S-transferases is essential for accurate experimental interpretation. Several approaches can be employed:

  • Subcellular fractionation: MGST1 distributes with endoplasmic reticulum markers during subcellular fractionation, unlike cytosolic GSTs . Differential centrifugation can effectively separate these enzyme populations.

  • Response to inducers: Unlike cytosolic GSTs, microsomal MGST1 is not significantly induced by classical inducers of drug-metabolizing enzymes such as phenobarbital, methylcholanthrene, and trans-stilbene oxide .

  • Activation by N-ethylmaleimide: MGST1 can be activated up to eight-fold by N-ethylmaleimide treatment, a characteristic not shared by cytosolic GSTs .

  • Molecular weight: Rat MGST1 has a predicted molecular mass of approximately 47 kDa (as a trimer), distinct from cytosolic GSTs .

  • Antibody-based detection: Using specific antibodies that recognize MGST1 but not cytosolic GSTs can allow immunological distinction between these enzyme classes.

  • Membrane association: Treatment with alkaline Na₂CO₃ or proteases can help distinguish between membrane-bound MGST1 and potentially contaminating cytosolic GSTs in membrane preparations .

By employing these approaches, researchers can ensure they are specifically studying MGST1 without interference or confounding effects from cytosolic glutathione S-transferases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.