Recombinant Rat Mitochondrial 2-oxoglutarate/malate carrier protein (Slc25a11)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

  • Gene: Encoded by SLC25A11 (rat ortholog: Slc25a11).

  • Structure: A multi-pass transmembrane protein (314 amino acids) with six α-helical domains, characteristic of mitochondrial carriers .

  • Localization: Inner mitochondrial membrane .

  • Function:

    • Catalyzes the exchange of 2-oxoglutarate for malate, supporting the malate-aspartate shuttle (MAS) and oxoglutarate/isocitrate shuttle .

    • Maintains mitochondrial membrane potential, cristae morphology, and fusion/fission dynamics .

    • Regulates apoptosis and nitrogen metabolism .

Key Functional Partners

Protein PartnerRole in Mitochondrial FunctionInteraction Score
UQCRC1Component of Complex III (electron transport)0.725
NDUFS2Core subunit of Complex I (NADH dehydrogenase)0.699
CYC1Cytochrome c1 in Complex III0.646
Data from STRING interaction network analysis

Malate-Aspartate Shuttle (MAS)

Slc25a11 enables the transport of cytosolic NADH into mitochondria via MAS, critical for:

  • ATP production: Supports oxidative phosphorylation by reducing NAD+ in the mitochondrial matrix .

  • Redox balance: Maintains glutathione (GSH) levels by importing 2-oxoglutarate, which is linked to GSH synthesis .

Dual Role in Proton Transport

Recent studies reveal Slc25a11 may facilitate proton transport under specific conditions:

  • Mechanism: Requires long-chain fatty acids (FAs) or 2,4-dinitrophenol (DNP) as protonophores .

  • Key Residue: Arginine 90 (R90) binds FAs, ATP, 2-oxoglutarate, and malate, modulating proton conductance .

Cancer Metabolism

Cancer TypeExpression LevelPhenotypic Impact
NSCLCHighReduced ATP, apoptosis upon knockdown
MelanomaHighInhibited proliferation, tumor suppression
Liver CancerLowPoor prognosis (shorter OS/RFS)
PancreaticHighCorrelates with CD8+ T-cell infiltration
Data synthesized from
  • Mechanistic Insights:

    • NSCLC/Melanoma: Slc25a11 knockdown depletes ATP, inactivates mTOR signaling, and reduces c-Myc expression, leading to apoptosis .

    • Liver Cancer: Low Slc25a11 correlates with advanced stages and poor survival, likely due to impaired redox balance .

    • Pancreatic Cancer: High expression associates with tumor-infiltrating immune cells (e.g., CD8+ T-cells, macrophages) .

Therapeutic Potential

  • Targeting Slc25a11: Inhibitors (e.g., hemin) disrupt 2-oxoglutarate transport, reducing cancer cell viability .

  • Prognostic Biomarker: Validated in liver cancer (ROC AUC = 0.635) .

Experimental Models

  • Planar Lipid Bilayers: Slc25a11 increases membrane conductance (G<sub>m</sub>) in the presence of FAs/DNP, enabling proton transport studies .

  • Proteoliposomes: Used to measure 14C-malate uptake kinetics and hemin inhibition (e.g., IC<sub>50</sub> ≈ 0.082 μM for internal hemin) .

Kinetic Parameters

ParameterValue (Malate Uptake)Experimental Condition
K<sub>m</sub>50 μMProteoliposomes with hemin
V<sub>max</sub>↓ 30%Hemin (matrix-side inhibition)
IC<sub>50</sub>0.082 μMInternal hemin
Data from kinetic analyses

Future Directions

  1. Structural Elucidation: High-resolution imaging of Slc25a11 with bound substrates (e.g., 2-oxoglutarate, FAs).

  2. Therapeutic Development: Designing inhibitors targeting R90 or FA-binding sites for cancer treatment .

  3. Tissue-Specific Roles: Investigating Slc25a11’s dual expression patterns in cancers (e.g., upregulated vs. downregulated).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag.
Synonyms
Slc25a11; Slc20a4; Mitochondrial 2-oxoglutarate/malate carrier protein; OGCP; Solute carrier family 25 member 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-314
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Slc25a11
Target Protein Sequence
AATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVXNRMQLSGEGAKTREY KTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLL KALIGMTAGATGAFVGPPAEVALIRMTADGRLPADQRRGYKNVFNALIRIAREEGVPTLW RGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCAIMISGLVTTAASMPVD IVKTRIQNMRMIDEKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLE QMNKAYKRLFLSG
Uniprot No.

Target Background

Function
The mitochondrial 2-oxoglutarate/malate carrier protein (Slc25a11) facilitates the transport of 2-oxoglutarate across the inner mitochondrial membrane. This process involves an electroneutral exchange for malate or other dicarboxylic acids. Slc25a11 plays a crucial role in several metabolic pathways, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, gluconeogenesis from lactate, and nitrogen metabolism. Furthermore, it contributes to maintaining mitochondrial fusion and fission events, as well as the organization and morphology of cristae. Slc25a11 is also involved in the regulation of apoptosis.
Gene References Into Functions
  1. The oxoglutarate carrier functions cooperatively to maintain the mitochondrial glutathione pool, which is essential for neuronal survival. PMID: 24606213
  2. Bcl-2 and 2-oxoglutarate carrier work together to increase the mitochondrial glutathione pool, enhancing cell resistance to oxidative stress. PMID: 22115789
  3. The oxoglutarate/malate carrier in rat brain mitochondria operates through a uniport exchange mechanism. PMID: 20820893
  4. The OGC is part of a mechanism for fuel-stimulated insulin secretion, common to glucose, amino acid, and organic acid secretagogues. This mechanism involves flux through the pyruvate/isocitrate cycling pathway. PMID: 20356834
  5. Data provide evidence for a role of the 2-oxoglutarate carrier as a glutathione transporting polypeptide. PMID: 12939596
  6. Porphyrin accumulation in mitochondria is mediated by OGC. Porphyrins can competitively inhibit 2-oxoglutarate uptake into mitochondria. PMID: 16920706
Database Links

KEGG: rno:64201

STRING: 10116.ENSRNOP00000005144

UniGene: Rn.853

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Slc25a11 in mitochondrial metabolism?

Slc25a11, also known as the mitochondrial 2-oxoglutarate/malate carrier protein, serves as a critical transporter in the mitochondrial inner membrane. Its primary function involves facilitating the exchange of 2-oxoglutarate for malate across the mitochondrial inner membrane, which is essential for maintaining the malate-aspartate shuttle (MAS). This shuttle mechanism is fundamental for transporting reducing equivalents (NADH) from the cytosol into the mitochondria, thereby supporting oxidative phosphorylation and cellular energetics. Additionally, Slc25a11 functions as a mitochondrial glutathione (GSH) transporter, importing GSH into mitochondria to maintain redox homeostasis within this organelle . This GSH transport function is particularly critical for protecting mitochondria against oxidative damage and preventing ferroptosis, a form of regulated cell death characterized by iron-dependent lipid peroxidation.

How does Slc25a11 differ structurally and functionally from other members of the SLC25 carrier family?

Slc25a11 belongs to the SLC25 family of mitochondrial carriers, which consists of numerous members with distinct transport functions. While sharing the characteristic three tandem repeat structure common to SLC25 carriers, Slc25a11 possesses unique substrate binding sites that confer its specificity for 2-oxoglutarate and malate. Unlike SLC25a10 (dicarboxylate carrier), which can transport succinate, phosphate, thiosulfate, and malate, Slc25a11 demonstrates higher substrate selectivity .

The functional distinction of Slc25a11 lies in its essential role in both the malate-aspartate shuttle and mitochondrial GSH transport. Unlike some other SLC25 carriers that may be localized to multiple subcellular compartments (such as SLC25a17, which targets peroxisomes), Slc25a11 is predominantly localized to the mitochondrial inner membrane . This exclusive mitochondrial localization underscores its specialized function in maintaining mitochondrial metabolism and redox homeostasis.

What are the key interacting partners of Slc25a11 and how do these interactions affect its function?

Recent research has identified FUNDC2 (FUN14 domain-containing protein 2) as a key interacting partner of Slc25a11. This interaction has significant functional consequences for mitochondrial GSH transport and ferroptosis regulation. Tandem affinity purification combined with mass spectrometry analysis revealed that FUNDC2 specifically interacts with SLC25A11 in multiple cell types, including HeLa and MEF cells . This interaction is specific, as FUNDC2 does not interact with SLC25A10, another mitochondrial carrier involved in GSH transport.

The FUNDC2-SLC25A11 interaction modulates mitochondrial GSH levels and the GSH/GSSG ratio, which are critical determinants of cellular resistance to ferroptosis. Structure-function analysis has pinpointed the Q64 residue of FUNDC2 in the intermembrane space of mitochondria as indispensable for this interaction. When this interaction is disrupted, mitochondrial GSH/GSSG ratios are significantly altered, affecting cellular susceptibility to ferroptotic stimuli . This molecular partnership represents a novel regulatory mechanism controlling mitochondrial redox homeostasis and ferroptosis sensitivity.

What are the most effective approaches for measuring Slc25a11 transport activity in research settings?

Several complementary approaches can be employed to effectively measure Slc25a11 transport activity, each with distinct advantages depending on the research question:

  • Radiolabeled substrate transport assays: This classic approach involves measuring the transport of radiolabeled 2-oxoglutarate or malate across mitochondrial membranes. Transport kinetics can be assessed by terminating the reaction through centrifugal filtration, followed by quantification of transported molecules in the mitochondrial pellet and supernatant . This method provides direct quantitative assessment of transport rates but requires appropriate controls with structurally similar molecules to confirm specificity.

  • Liposome reconstitution systems: For the most controlled assessment of transport activity, recombinant Slc25a11 can be expressed in E. coli, purified, and reconstituted in liposomes with a lipid composition mimicking the mitochondrial inner membrane (particularly including cardiolipin). This approach eliminates confounding factors from other transporters and allows precise characterization of transport kinetics and substrate specificity .

  • Mitochondrial swelling assays: This technique measures changes in light-scattering properties of a mitochondrial suspension when transport of osmotically active compounds occurs. For Slc25a11, the transport of 2-oxoglutarate can be monitored by a decrease in light scattering, indicating mitochondrial swelling . While this method is relatively straightforward, its sensitivity may be limited when expression levels are low.

  • Yeast complementation studies: Expression of rat Slc25a11 in S. cerevisiae mutants lacking the endogenous 2-oxoglutarate/malate carrier can provide functional validation through phenotype rescue experiments . This approach is particularly valuable for structure-function studies involving mutated versions of Slc25a11.

Each method should be accompanied by appropriate controls, including transport assays with structurally related molecules to confirm specificity and the use of known inhibitors when available.

What are the optimal methods for Slc25a11 knockdown or knockout in experimental models?

Based on the research literature, several effective approaches have been established for Slc25a11 knockdown or knockout:

  • siRNA-mediated transient knockdown: This approach has been successfully used to downregulate Slc25a11 in various cell lines. The target sequence 5'-CCTCTTACTCTCAATCTAA-3' has been validated for mouse Slc25a11 . Transfection using RNAiMAX has proven effective, with significant protein reduction typically achieved within 24-72 hours.

  • shRNA-mediated stable knockdown: For longer-term studies, stable knockdown using shRNA has been successfully employed in multiple cancer cell lines, including A549, A375, H226, and UACC62 . This approach enables extended experiments, including in vivo xenograft studies, and typically achieves 50-100% reduction in colony formation capacity.

  • CRISPR-Cas9 gene editing for knockout models: For complete gene ablation, CRISPR-Cas9 technology has been used to generate Slc25a11 knockout models. In mice, sgRNA sequences 5'-ACTGCATCCGGTTCTTCACC-3' and 5'-CGGATGCAGTTGAGTGGTGA-3' targeting exon 2 have been successfully employed . It's important to note that complete Slc25a11 knockout in mice is embryonic lethal, necessitating the use of heterozygous models or conditional knockouts for in vivo studies.

When designing knockdown or knockout experiments, researchers should consider that:

  • Complete Slc25a11 knockout may be lethal in certain model systems, requiring careful experimental design

  • Phenotypic effects may vary between normal and cancer cells, with cancer cells showing greater sensitivity to Slc25a11 depletion

  • Validation of knockdown efficiency should be performed at both mRNA and protein levels

  • Rescue experiments with wild-type Slc25a11 expression should be included to confirm specificity of observed phenotypes

What techniques are most reliable for assessing mitochondrial GSH transport mediated by Slc25a11?

To reliably assess mitochondrial GSH transport mediated by Slc25a11, researchers can employ several complementary techniques:

When performing these assessments, researchers should be aware that mitochondrial isolation quality significantly impacts measurement accuracy, and controls should include assessment of mitochondrial integrity and purity.

How does Slc25a11 regulate mitochondrial redox homeostasis through GSH transport?

Slc25a11 plays a critical role in maintaining mitochondrial redox homeostasis primarily through its function as a mitochondrial GSH transporter. As mitochondria cannot synthesize GSH de novo, they rely on cytosolic import of this critical antioxidant, with Slc25a11 serving as a key transporter for this process. The mechanism operates as follows:

Slc25a11 facilitates the transport of GSH from the cytosol into the mitochondrial matrix, where it serves as the primary defense against reactive oxygen species (ROS) generated during oxidative phosphorylation. Within mitochondria, GSH functions as a substrate for glutathione peroxidase 4 (GPX4), which neutralizes lipid hydroperoxides and prevents their accumulation . This activity is particularly crucial for preventing ferroptosis, a form of regulated cell death characterized by iron-dependent lipid peroxidation.

Research has demonstrated that Slc25a11 knockdown significantly decreases the mitochondrial GSH/GSSG ratio without substantially affecting cytosolic GSH levels . This selective impact on mitochondrial GSH underscores Slc25a11's specific role in maintaining compartmentalized redox homeostasis. The importance of this function is highlighted by the finding that Slc25a11 deficiency enhances cellular sensitivity to ferroptosis inducers like erastin, with increased lipid ROS accumulation and cell death .

Furthermore, the Slc25a11-dependent GSH transport system appears to be regulated through protein-protein interactions, particularly with FUNDC2. This interaction serves as a molecular switch that modulates mitochondrial GSH levels in response to cellular stressors, providing a dynamic mechanism for adjusting mitochondrial redox status according to metabolic demands .

What role does Slc25a11 play in cancer cell metabolism compared to normal cells?

Slc25a11 exhibits differential effects in cancer versus normal cells, suggesting it may be a potential therapeutic target with selective effects on malignant cells. The research evidence demonstrates several key distinctions:

Cancer cells:

  • Slc25a11 knockdown significantly decreases colony formation by 50-100% across multiple non-small cell lung cancer (NSCLC) and melanoma cell lines

  • Depletion induces substantial cell death (up to 400% increase in apoptosis after 72 hours) in cancer cell lines like A549 and UACC62

  • Reduces mitochondrial membrane potential by 30-40% in cancer cells

  • Decreases oxygen consumption rate (OCR) by 36-45% within 24 hours of knockdown

  • Leads to ATP depletion prior to apoptosis onset, suggesting energy crisis as a primary mechanism of cell death

  • In vivo knockdown results in tumors approximately one-fifth the size of controls in multiple cancer xenograft models

Normal cells:

  • Slc25a11 knockdown has no significant effect on ATP production in IMR90 normal human lung fibroblasts under standard culture conditions

  • Does not alter mitochondrial membrane potential in normal cells

  • Shows minimal impact on proliferation of non-transformed cells

This differential sensitivity likely reflects the heightened dependence of cancer cells on Slc25a11 functions for maintaining their altered metabolic state. Cancer cells typically exhibit elevated mitochondrial activity and increased sensitivity to redox perturbations, making them more vulnerable to disruptions in Slc25a11-mediated transport processes. These findings suggest that targeting Slc25a11 could potentially provide a therapeutic window that selectively affects cancer cells while sparing normal tissues .

How does Slc25a11 interact with the ferroptosis pathway, and what experimental approaches best capture this relationship?

Slc25a11 plays a pivotal role in regulating cellular sensitivity to ferroptosis through its function in mitochondrial GSH transport. The relationship between Slc25a11 and ferroptosis can be experimentally investigated through several complementary approaches:

  • Cell viability assays with ferroptosis inducers: Treatment of Slc25a11-depleted cells with ferroptosis inducers like erastin reveals significantly enhanced sensitivity compared to control cells. This is quantifiable through standard viability assays (MTT, CellTiter-Glo) and cell death measurements (Annexin V staining, LDH release) .

  • Lipid peroxidation assessment: Since ferroptosis is characterized by accumulation of lipid peroxides, measurement of lipid ROS using C11-BODIPY or TBARS assays in Slc25a11-manipulated cells provides direct evidence of its impact on ferroptotic processes. Research has demonstrated significantly increased lipid ROS accumulation following Slc25a11 knockdown in response to erastin treatment .

  • Rescue experiments with ferroptosis inhibitors: If Slc25a11 depletion induces ferroptosis, then treatment with specific ferroptosis inhibitors like ferrostatin-1 should rescue the associated phenotypes. Indeed, studies have shown that ferrostatin-1 can counteract the effects of Slc25a11 deficiency, confirming the ferroptotic nature of the cell death .

  • Analysis of GPX4 expression and function: As a key downstream effector in the ferroptosis pathway, examining GPX4 protein levels and activity in Slc25a11-depleted cells helps establish the mechanistic link between mitochondrial GSH transport and ferroptosis regulation.

  • Mitochondrial morphology and integrity assessment: Electron microscopy examination of mitochondria in Slc25a11-depleted cells reveals characteristic changes associated with ferroptosis, including smaller mitochondria with increased membrane density and reduced cristae .

The molecular mechanism connecting Slc25a11 to ferroptosis involves its role in maintaining adequate mitochondrial GSH levels, which are essential for GPX4 function. GPX4 requires GSH as a cofactor to neutralize lipid hydroperoxides, preventing the cascade of lipid peroxidation that drives ferroptosis. When Slc25a11 function is compromised, mitochondrial GSH levels decline, impairing GPX4 activity and increasing cellular vulnerability to ferroptosis triggers .

What evidence supports the role of Slc25a11 in cancer progression, and how can this be experimentally validated?

Substantial evidence supports Slc25a11's role in cancer progression, with data from both in vitro and in vivo experimental models:

In vitro evidence:

  • Slc25a11 knockdown dramatically reduces colony formation capacity by 50-100% across multiple NSCLC and melanoma cell lines

  • Time-course analysis reveals progressive increases in cancer cell death following Slc25a11 depletion, reaching up to 400% increase in apoptosis after 72 hours in UACC62 and A549 cells

  • Slc25a11 depletion significantly decreases mitochondrial membrane potential and oxygen consumption rate in cancer cells, leading to ATP depletion prior to cell death

  • The effects of Slc25a11 knockdown can be rescued by overexpression of wild-type Slc25a11, confirming specificity of the observed phenotypes

In vivo evidence:

  • Xenograft experiments with Slc25a11 knockdown in A549, A375, H226, and UACC62 cell lines demonstrate that tumors formed by Slc25a11-depleted cells are approximately one-fifth the size of control tumors

  • Immunohistochemical analysis reveals significantly reduced c-Myc staining in Slc25a11 knockdown tumors compared to wild-type controls, indicating decreased proliferative activity

  • Genetic studies in mice show that Slc25a11 heterozygosity (complete knockout is embryonic lethal) suppresses K-ras-mediated lung tumorigenesis, with tumor nodule numbers and areas reduced by approximately 60% and 54%, respectively, compared to K-ras mice with wild-type Slc25a11

Experimental validation approaches:

  • Loss-of-function studies: siRNA or shRNA knockdown in diverse cancer cell lines, followed by assessment of proliferation, colony formation, and metabolic parameters

  • Xenograft models: Implantation of Slc25a11-depleted cancer cells in immunocompromised mice to evaluate tumor growth kinetics

  • Genetic mouse models: Crossing Slc25a11 heterozygous mice with oncogene-driven cancer models (as demonstrated with K-ras LA2 mice) to assess tumor initiation and progression

  • Pharmacological targeting: Development and testing of small molecule inhibitors of Slc25a11 transport function in cancer models

  • Clinical correlation studies: Analysis of Slc25a11 expression in human tumor samples and correlation with clinical outcomes and metabolic parameters

These multiple lines of evidence collectively support Slc25a11 as a potential therapeutic target in cancer, with particular relevance in contexts where mitochondrial metabolism is critical for tumor progression.

How does Slc25a11 function contribute to mitochondrial integrity during oxidative stress?

Slc25a11 plays a critical role in maintaining mitochondrial integrity during oxidative stress through several interconnected mechanisms:

  • Facilitating mitochondrial GSH transport: As a key mitochondrial GSH transporter, Slc25a11 ensures adequate GSH levels within the mitochondrial matrix. This GSH pool is essential for neutralizing reactive oxygen species (ROS) generated during increased respiratory activity or under oxidative stress conditions . Research has demonstrated that Slc25a11 knockdown significantly decreases mitochondrial GSH/GSSG ratios, compromising the organelle's antioxidant capacity .

  • Supporting GPX4 function: Mitochondrial GSH transported by Slc25a11 serves as a critical cofactor for glutathione peroxidase 4 (GPX4), which neutralizes lipid hydroperoxides within mitochondrial membranes. This activity prevents the propagation of lipid peroxidation chains that would otherwise compromise mitochondrial membrane integrity .

  • Maintaining mitochondrial membrane potential: Experimental evidence shows that Slc25a11 depletion leads to a significant decrease in mitochondrial membrane potential in various cell types . This suggests that Slc25a11-mediated transport processes are essential for preserving the electrochemical gradient necessary for mitochondrial function during stress conditions.

  • Preserving mitochondrial morphology: Studies indicate that proper Slc25a11 function is required to maintain normal mitochondrial morphology. When Slc25a11 function is compromised, especially under oxidative stress conditions induced by ferroptosis triggers, mitochondria exhibit characteristic morphological changes including reduced size, increased membrane density, and diminished cristae .

The importance of Slc25a11 in mitochondrial protection is further highlighted by the observation that specific depletion of mitochondrial GSH using mitoCDNB (a mitochondria-targeted GSH-depleting agent) phenocopies many of the effects seen with Slc25a11 knockdown, including enhanced sensitivity to ferroptosis inducers . This indicates that the mitochondrial GSH transport function of Slc25a11 is indeed critical for preserving mitochondrial integrity during oxidative stress.

What is known about the embryonic lethality of Slc25a11 knockout, and what does this reveal about its essential functions?

The embryonic lethality observed in Slc25a11 knockout mice provides compelling evidence for the essential nature of this transporter in development. Key observations and insights include:

  • Complete Slc25a11 knockout is embryonic lethal: Studies attempting to generate homozygous Slc25a11 knockout mice through cross-breeding of heterozygous animals have demonstrated that complete absence of Slc25a11 is incompatible with embryonic development . This finding is documented in breeding tables showing the absence of homozygous knockout offspring among live births.

  • Developmental timing of lethality: While the precise developmental stage at which Slc25a11 deficiency becomes lethal has not been fully characterized in the available literature, the embryonic lethality indicates that Slc25a11 function is required during early development, likely due to its essential role in energy metabolism and/or redox homeostasis.

  • Heterozygous mice are viable but show phenotypes: Slc25a11 heterozygous mice (SLC25A11+/-) are viable and develop normally, but demonstrate resistance to certain disease processes. For example, when crossed with KRAS LA2 mice (a model prone to developing lung tumors), the resulting KRAS LA2/SLC25A11+/- offspring exhibit significantly reduced lung tumorigenesis compared to KRAS LA2 mice with wild-type Slc25a11 .

The embryonic lethality of Slc25a11 knockout likely reflects several essential functions:

  • Critical role in energy metabolism: As a component of the malate-aspartate shuttle, Slc25a11 facilitates the transfer of reducing equivalents from cytosolic NADH into mitochondria, supporting oxidative phosphorylation. This function may be indispensable during embryonic development when energy demands are high.

  • Essential for mitochondrial redox balance: The GSH transport function of Slc25a11 is critical for maintaining mitochondrial redox homeostasis. During embryogenesis, proper redox balance is likely essential for signaling processes that regulate development.

  • Required for cell proliferation and differentiation: The dramatic effects of Slc25a11 knockdown on cell proliferation observed in various cell types suggest that it may be essential for the rapid cell proliferation characteristic of embryonic development.

These observations highlight the fundamental importance of Slc25a11 in basic cellular functions required for organismal development and suggest that targeted disruption strategies (tissue-specific or inducible knockouts) would be necessary for studying its function in adult organisms.

How does the FUNDC2-Slc25a11 interaction molecularly regulate mitochondrial GSH transport?

The FUNDC2-Slc25a11 interaction represents a sophisticated regulatory mechanism controlling mitochondrial GSH transport and ferroptosis sensitivity. Research has revealed several key molecular aspects of this interaction:

The interaction between FUNDC2 and Slc25a11 was initially identified through tandem affinity purification (TAP) combined with mass spectrometry, revealing Slc25a11 as a significant binding partner of FUNDC2 . This interaction was subsequently confirmed through co-immunoprecipitation analyses in multiple cell types, including HeLa and MEF cells, and visualized using super-resolution microscopy (structure illumination microscopy, SIM) .

At the molecular level, the interaction is highly specific - FUNDC2 interacts with Slc25a11 but not with the related carrier SLC25A10, despite SLC25A10 also being involved in GSH transport . Structure-function analyses have identified the Q64 residue of FUNDC2, located in the intermembrane space of mitochondria, as indispensable for this interaction. Alanine scanning analysis revealed that mutation of this residue disrupts the FUNDC2-Slc25a11 interaction and significantly alters mitochondrial GSH/GSSG ratios .

Functionally, this interaction appears to modulate the efficiency of Slc25a11-mediated GSH transport into mitochondria. Experiments demonstrate that FUNDC2 knockout decreases mitochondrial GSH levels and enhances cellular sensitivity to ferroptosis triggers like erastin . Importantly, the effects of FUNDC2 deficiency on ferroptosis sensitivity can be rescued by overexpression of Slc25a11, confirming that FUNDC2 operates upstream of Slc25a11 in regulating ferroptosis sensitivity .

The precise mechanism by which FUNDC2 modulates Slc25a11 activity remains incompletely understood but may involve:

  • Allosteric regulation of Slc25a11 transport activity

  • Stabilization of Slc25a11 protein levels

  • Facilitation of Slc25a11 localization or insertion into the inner mitochondrial membrane

  • Modulation of Slc25a11's interaction with other regulatory proteins

This regulatory system appears to be particularly important under stress conditions, such as during exposure to ferroptosis inducers, where proper mitochondrial GSH levels are critical for cell survival .

What are the structural determinants of Slc25a11 that confer its substrate specificity?

Understanding the structural determinants of Slc25a11 substrate specificity remains an area of active investigation, with several key insights available from comparative analyses with other SLC25 family members and limited structure-function studies:

While the complete crystal structure of rat Slc25a11 has not been definitively determined, structural modeling based on related SLC25 carriers suggests that Slc25a11 adopts the characteristic structure of mitochondrial carriers featuring:

  • Six transmembrane helices arranged in three similar domains

  • A three-fold pseudo-symmetry

  • A substrate binding site located approximately in the middle of the membrane

The substrate binding pocket of Slc25a11 contains specific residues that interact with 2-oxoglutarate and malate, conferring its substrate selectivity. Unlike SLC25A10 (dicarboxylate carrier), which can transport a broader range of substrates including succinate, phosphate, thiosulfate, and malate, Slc25a11 shows higher specificity for 2-oxoglutarate and malate exchange .

Research on other SLC25 carriers suggests that charged residues lining the translocation pathway are critical for substrate recognition. For Slc25a11, positively charged residues in the substrate binding pocket likely interact with the carboxyl groups of 2-oxoglutarate and malate. These interaction sites represent potential targets for structure-function studies through site-directed mutagenesis.

The transport mechanism of Slc25a11, like other mitochondrial carriers, likely involves conformational changes that alternately expose the substrate binding site to either side of the membrane. This "single binding center gated pore" mechanism has been described for related carriers .

The lipid environment, particularly the dimeric lipid cardiolipin found in the inner mitochondrial membrane, plays an important role in the proper functioning of SLC25 carriers including Slc25a11 . This highlights the importance of using appropriate lipid compositions when reconstituting Slc25a11 in liposomes for functional studies.

Further research employing techniques such as cryo-electron microscopy, nuclear magnetic resonance spectroscopy, and computational modeling will be valuable for elucidating the precise structural determinants of Slc25a11 substrate specificity and transport mechanism.

How might post-translational modifications regulate Slc25a11 activity in different cellular contexts?

Post-translational modifications (PTMs) likely represent an important regulatory layer controlling Slc25a11 activity across different cellular contexts and stress conditions, though this area remains incompletely characterized. Based on research on related transporters and cellular signaling pathways, several potential regulatory mechanisms can be proposed:

  • Phosphorylation: Kinase-mediated phosphorylation represents a common mechanism for rapid regulation of protein activity. While specific phosphorylation sites on rat Slc25a11 have not been extensively characterized in the available literature, phosphoproteomic studies of related carriers suggest that phosphorylation could modulate transport activity by:

    • Altering substrate binding affinity

    • Modifying protein-protein interactions (such as with FUNDC2)

    • Changing conformational dynamics during the transport cycle

  • Redox-based modifications: Given Slc25a11's role in GSH transport and redox homeostasis, its activity may be regulated by redox-sensitive modifications:

    • Oxidation of critical cysteine residues could serve as a feedback mechanism during oxidative stress

    • S-glutathionylation might provide a direct link between cellular GSH status and transporter activity

    • These modifications could become particularly relevant during oxidative stress conditions

  • Ubiquitination and protein stability regulation: The cellular levels of Slc25a11 might be controlled through ubiquitination and subsequent proteasomal degradation, providing a mechanism for longer-term adaptation to altered metabolic states.

  • Protein-protein interactions: Beyond FUNDC2, Slc25a11 may interact with other regulatory proteins in a context-dependent manner. These interactions could be modulated by cellular signaling pathways, metabolic status, or stress conditions.

In cancer cells, which show heightened sensitivity to Slc25a11 depletion compared to normal cells, these regulatory mechanisms might be altered to support the increased metabolic demands of rapidly proliferating cells . Understanding the specific PTMs regulating Slc25a11 in different cellular contexts represents an important area for future research and could potentially reveal new therapeutic approaches for conditions where Slc25a11 activity plays a critical role.

What are common challenges when expressing recombinant Slc25a11, and how can they be overcome?

Researchers working with recombinant Slc25a11 commonly encounter several challenges during expression, purification, and functional characterization. Here are the major issues and evidence-based solutions:

  • Protein misfolding and aggregation:

    • Challenge: As a hydrophobic membrane protein, Slc25a11 tends to aggregate during heterologous expression, particularly in bacterial systems.

    • Solutions:

      • Expression at lower temperatures (16-20°C) to slow protein synthesis and facilitate proper folding

      • Use of specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane protein expression

      • Addition of chemical chaperones like glycerol (5-10%) to expression media

      • Inclusion of mild detergents during cell lysis and purification stages

  • Low expression yields:

    • Challenge: Mitochondrial carriers often express poorly in heterologous systems due to toxicity or codon usage issues.

    • Solutions:

      • Codon optimization of the Slc25a11 sequence for the expression host

      • Use of tightly controlled inducible promoters (like pBAD) to minimize leaky expression

      • Expression as a fusion with solubility-enhancing tags (MBP, SUMO)

      • Scaling up culture volumes to compensate for low per-cell yields

  • Functional reconstitution issues:

    • Challenge: Maintaining Slc25a11 transport activity during purification and reconstitution.

    • Solutions:

      • Careful selection of detergents that preserve structure and function (e.g., DDM, LDAO)

      • Inclusion of cardiolipin in reconstitution mixtures to mimic the native mitochondrial membrane environment

      • Step-wise detergent removal using controlled dialysis or bio-beads

      • Addition of stabilizing agents like glycerol or specific lipids during purification

  • Proper orientation in liposomes:

    • Challenge: Ensuring uniform orientation of Slc25a11 in reconstituted liposomes for accurate transport assays.

    • Solutions:

      • Use of freeze-thaw cycles during reconstitution to promote proper insertion

      • Careful pH control during reconstitution based on the charged residues in Slc25a11

      • Verification of orientation using protease protection assays or antibodies against domain-specific epitopes

By addressing these challenges methodically, researchers can successfully express and reconstitute functional Slc25a11 for detailed biochemical and structural studies.

How can researchers address data discrepancies between in vitro and in vivo studies of Slc25a11 function?

Addressing discrepancies between in vitro and in vivo studies of Slc25a11 requires systematic approaches to reconcile differences that may arise from experimental context, compensatory mechanisms, or technical limitations:

  • Identifying sources of discrepancy:

    • Compensatory mechanisms: In vivo, other transporters may partially compensate for Slc25a11 deficiency, masking phenotypes observed in isolated systems. For example, while complete Slc25a11 knockout is embryonic lethal, heterozygous mice are viable but show resistance to certain disease processes like Kras-driven lung tumorigenesis .

    • Cell type specificity: Slc25a11 function may vary significantly between different tissues or cell types. Research has shown that cancer cells and normal cells respond differently to Slc25a11 knockdown, with cancer cells showing heightened sensitivity .

    • Timescale differences: Acute perturbations in vitro may produce effects that differ from chronic adaptations possible in vivo.

  • Methodological approaches to reconcile discrepancies:

    • Utilize intermediate models: Bridge the gap between simple in vitro systems and complex in vivo models using:

      • 3D organoid cultures that better recapitulate tissue architecture

      • Ex vivo tissue slices that maintain cell-cell interactions

      • Conditional knockout models that allow temporal control of Slc25a11 depletion

    • Apply consistent analytical techniques: Use identical assays across in vitro and in vivo studies when possible, such as:

      • Measuring the same metabolic parameters (GSH/GSSG ratios, mitochondrial membrane potential)

      • Employing consistent methods for assessing cell death or proliferation

      • Using the same pharmacological probes or genetic constructs

    • Validate with orthogonal approaches: Confirm findings using multiple independent methods:

      • Combine genetic manipulations (knockdown/knockout) with pharmacological interventions

      • Use both gain-of-function and loss-of-function approaches

      • Employ rescue experiments to confirm specificity

  • Specific strategies for Slc25a11 studies:

    • When studying Slc25a11's role in ferroptosis, compare responses to multiple ferroptosis inducers (erastin, RSL3, etc.) both in vitro and in vivo

    • For cancer-related studies, use both cell line xenografts and genetic mouse models (like the KRAS LA2/SLC25A11+/- model) to validate findings

    • Consider metabolic context (nutrient availability, oxygen levels) as a potential source of discrepancy between controlled in vitro and variable in vivo environments

By systematically addressing these factors, researchers can develop more coherent models of Slc25a11 function that integrate insights from different experimental contexts.

What controls are essential when investigating the effect of Slc25a11 on ferroptosis and mitochondrial GSH transport?

  • Genetic manipulation controls:

    • Rescue experiments: After Slc25a11 knockdown, re-expression of wild-type Slc25a11 should reverse observed phenotypes, confirming specificity of the effects . This is particularly important when assessing mitochondrial membrane potential, ATP levels, and GSH transport.

    • Multiple knockdown approaches: Use both transient (siRNA) and stable (shRNA) knockdown methods to rule out off-target or adaptation effects .

    • Targeted vs. non-targeted controls: Include both scramble siRNA/shRNA controls and untreated controls to distinguish between knockdown-specific effects and transfection-related stress.

  • Compartment-specific controls:

    • Cytosolic vs. mitochondrial measurements: Always measure both mitochondrial and cytosolic GSH/GSSG ratios to confirm the specificity of Slc25a11's effects on mitochondrial rather than total cellular GSH .

    • Mitochondrial fraction purity verification: Include markers for mitochondrial purity (COX4, TOM20) and contamination (GAPDH, Histone H3) when isolating mitochondria for GSH measurements.

    • Subcellular localization confirmation: Verify Slc25a11 localization using fractionation and imaging approaches to confirm its mitochondrial inner membrane positioning.

  • Ferroptosis-specific controls:

    • Ferroptosis inhibitor rescue: Treatment with ferrostatin-1 or other specific ferroptosis inhibitors should reverse cell death phenotypes if they are truly ferroptosis-related .

    • Comparison with established ferroptosis inducers: Include canonical ferroptosis inducers (erastin, RSL3) as positive controls.

    • Lipid peroxidation measurements: Confirm increased lipid ROS using specific probes (C11-BODIPY) to verify the ferroptotic nature of observed cell death .

    • GPX4 status evaluation: Assess GPX4 protein levels and activity as a downstream mediator of ferroptosis resistance.

  • Specificity controls:

    • Related transporter comparisons: Include experiments with related transporters like SLC25A10 to confirm the specific role of Slc25a11 .

    • Selective GSH depletion: Use mitochondria-targeted GSH-depleting agents like mitoCDNB as positive controls to phenocopy Slc25a11 depletion effects .

    • Interaction specificity verification: When studying protein-protein interactions (like FUNDC2-Slc25a11), include controls for non-specific binding and verify interactions through multiple techniques (co-IP, proximity ligation, microscopy) .

  • Cell type controls:

    • Normal vs. cancer cell comparisons: Include both cancer cell lines and non-transformed cells (like IMR90 fibroblasts) to identify context-dependent effects of Slc25a11 manipulation .

    • Multiple cell line validation: Test effects across diverse cancer types and cellular backgrounds to ensure generalizability of findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.