Recombinant Rat Mitochondrial carnitine/acylcarnitine carrier protein CACL (Slc25a29)

Shipped with Ice Packs
In Stock

Description

Function and Characteristics of Slc25a29

Slc25a29 is a member of the solute carrier family 25 (SLC25), which includes mitochondrial carriers responsible for transporting various substrates across the inner mitochondrial membrane. The primary role of Slc25a29 is to facilitate the import of basic amino acids, such as arginine and lysine, into mitochondria. This process is essential for mitochondrial protein synthesis and amino acid degradation .

Key Transported Substrates:

  • Arginine

  • Lysine

  • Homoarginine

  • Methylarginine

  • Ornithine (to a lesser extent)

  • Histidine (to a lesser extent)

Not Transported:

  • Carnitine

  • Acylcarnitines

Research Findings and Implications

Research on Slc25a29 has shown that it exhibits both uniport and counter-exchange transport mechanisms. It has a high affinity for arginine and lysine, and its activity is inhibited by mercurial compounds and other mitochondrial carrier inhibitors .

SubstrateTransport EfficiencyMechanism
ArginineHighUniport/Exchange
LysineHighUniport/Exchange
OrnithineLowUniport/Exchange
HistidineLowUniport/Exchange
CarnitineNot transported-

Role in Disease and Metabolic Pathways

Slc25a29 has been identified as the third human mitochondrial ornithine transporter (ORNT3), which may contribute to the milder phenotype observed in patients with hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome by providing redundant function to the primary ornithine transporter ORNT1 . Additionally, elevated levels of Slc25a29 have been associated with improved arginine transport into mitochondria in cancer cells, potentially impacting cancer metabolism .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Slc25a29; Ornt3; Mitochondrial basic amino acids transporter; Carnitine/acylcarnitine translocase-like; CACT-like; Mitochondrial carnitine/acylcarnitine carrier protein CACL; Mitochondrial ornithine transporter 3; Solute carrier family 25 member 29
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc25a29
Target Protein Sequence
MALDFLAGCAGGVAGVIVGHPFDTVKVRLQVQNTEKPQYRGTLHCFQSIIKQESVLGLYK GLGSPLMGLTFINALVFGVQGNTLRALGQDSPLNQFLAGAAAGAIQCVICCPMELAKTRL QLQAAGPARAYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVLTRAMG CEPGDRLLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQ AEGWQVFTRGLASTLLRAFPVNAATFATVTVVLTYIRGEEDQVDSEAAPGASTTPAGPAL AQPSSL
Uniprot No.

Target Background

Function
This protein facilitates the transport of arginine, lysine, homoarginine, methylarginine, and to a lesser extent, ornithine and histidine. It can restore ornithine transport in cells lacking the primary mitochondrial ornithine transporter SLC25A15. It does not transport carnitine or acylcarnitines. The protein functions through both counter-exchange and uniport mechanisms.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A29 and what is its primary function?

SLC25A29 is a member of the solute carrier family 25 (SLC25), also known as the mitochondrial carrier family. The protein is localized to the inner mitochondrial membrane and functions primarily as a transporter of basic amino acids, particularly arginine and lysine. Its main physiological role appears to be importing basic amino acids into mitochondria for mitochondrial protein synthesis and amino acid degradation . Although initially described as a carnitine/acylcarnitine-like carrier (CACL), thorough biochemical characterization has demonstrated that it transports basic amino acids with high specificity and does not transport carnitine or acylcarnitines .

What substrates are transported by SLC25A29?

SLC25A29 transports basic amino acids with the following preference: arginine and lysine with high efficiency, followed by homoarginine and methylarginine. Ornithine and histidine are transported to a much lesser extent. Notably, carnitine and acylcarnitines (including palmitoylcarnitine, octanoylcarnitine, propionylcarnitine, and miristoylcarnitine) are not transported by SLC25A29, despite earlier reports suggesting carnitine transport activity . The protein also does not transport glutamine, glutamate, GABA, aspartate, ATP, leucine, α-ketoisocaproic acid, NAD+, choline, valine, inorganic phosphate, malate, citrate, oxoglutarate, or sulfate .

What are the kinetic parameters of SLC25A29 transport activity?

SLC25A29 demonstrates high-affinity transport for both arginine and lysine. Kinetic analysis of reconstituted SLC25A29 revealed the following parameters:

SubstrateTransport Affinity (Km)Maximum Transport Rate (Vmax)
Arginine0.54 ± 0.08 mM1.79 ± 0.33 μmol/min/g protein
Lysine0.84 ± 0.16 mM1.76 ± 0.37 μmol/min/g protein

These values indicate that SLC25A29 has a slightly higher affinity for arginine compared to lysine, though the maximum transport rates are similar for both substrates . The transport follows Michaelis-Menten kinetics, as demonstrated by linear functions in double-reciprocal plots for both homoexchanges .

How do exchange and uniport mechanisms differ in SLC25A29 function?

SLC25A29 can catalyze both substrate exchange (counter-exchange) and unidirectional transport (uniport), with exchange occurring at significantly higher rates than uniport. In exchange reactions, SLC25A29 catalyzes the exchange of external substrates with internal substrates efficiently, particularly for arginine and lysine. In uniport reactions, SLC25A29 transports substrates across the membrane without a counter-substrate.

Why was SLC25A29 initially mischaracterized as a carnitine/acylcarnitine carrier?

The initial mischaracterization of SLC25A29 as a carnitine/acylcarnitine carrier likely occurred due to methodological limitations in earlier studies. Sekoguchi et al. (2003) reported low palmitoylcarnitine transport activity in E. coli and NIH3T3 cells expressing SLC25A29, leading to its designation as carnitine/acylcarnitine transporter-like (CACL) .

Later, Camacho and Rioseco-Camacho concluded that human and mouse SLC25A29 transport ornithine, designating them as ornithine transporter isoform 3 (ORNT3), based on rescue experiments in fibroblasts from patients with hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome .

The thorough biochemical characterization presented in the search results demonstrates that:

  • Carnitine and acylcarnitines show no measurable transport by purified, reconstituted SLC25A29

  • Direct measurements of transport using radiolabeled substrates show high activity for arginine and lysine, with lower activity for ornithine

  • Comprehensive controls and multiple experimental approaches consistently demonstrate the substrate specificity for basic amino acids

What experimental system is recommended for expressing and purifying SLC25A29?

For functional characterization of SLC25A29, the recommended expression system is E. coli. The methodology described in the search results involves:

  • Overexpression of the SLC25A29 gene in E. coli

  • Purification of the gene product

  • Reconstitution of the purified protein into phospholipid vesicles (liposomes)

This approach allows for direct measurement of transport activities using radiolabeled substrates. The E. coli expression system has been successfully used for numerous mitochondrial carriers and provides sufficient quantities of functional protein for thorough biochemical characterization .

What are the key methods for measuring SLC25A29 transport activity?

Several complementary approaches are recommended for measuring SLC25A29 transport activity:

  • Homoexchange experiments: Measuring the exchange of radiolabeled external substrates with the same substrate inside liposomes (e.g., [³H]arginine/arginine exchange)

  • Heteroexchange experiments: Measuring the exchange of a radiolabeled external substrate with a different internal substrate (e.g., [³H]arginine uptake in the presence of internal lysine)

  • Uniport measurements: Measuring the uptake of radiolabeled substrates into liposomes containing no substrate

  • Efflux experiments: Measuring the release of pre-loaded radiolabeled substrates from liposomes upon addition of external substrates

  • Inhibitor-stop method: Using specific inhibitors (like pyridoxal 5′-phosphate and HgCl₂) to terminate transport reactions at defined time points

The transport activity is typically quantified by measuring the radioactivity taken up by or released from the proteoliposomes under various conditions. Initial transport rates can be calculated from either the radioactivity taken up in the initial linear range (e.g., after 4 minutes) or from the time course of isotope equilibration .

How should researchers prepare proteoliposomes for SLC25A29 functional studies?

The preparation of proteoliposomes for SLC25A29 functional studies involves several critical steps:

  • Purification of recombinant protein: After expression in E. coli, the protein must be purified to homogeneity

  • Reconstitution into liposomes: The purified protein should be incorporated into phospholipid vesicles through a defined reconstitution procedure

  • Substrate loading: For exchange experiments, proteoliposomes should be preloaded with the desired internal substrate (typically at a concentration of 10 mM)

  • Removal of external substrate: External substrate must be removed from proteoliposomes using Sephadex G-75 columns pre-equilibrated with buffer (typically 10 mM HEPES-NaOH, pH 7.2)

  • Quality control: Control experiments should include liposomes without incorporated protein, boiled SLC25A29, and unrelated mitochondrial carriers to verify the specificity of transport activity

The protocol should be optimized to ensure consistent incorporation of functional SLC25A29 into the liposomal membrane, as this is critical for reliable transport measurements.

How can researchers distinguish between SLC25A29 and other mitochondrial carriers with overlapping substrate specificities?

Distinguishing SLC25A29 from other mitochondrial carriers requires careful experimental design and interpretation:

  • Substrate specificity profile: Compare transport rates across a comprehensive panel of potential substrates. SLC25A29 shows high activity for arginine and lysine, moderate activity for homoarginine and methylarginine, low activity for ornithine and histidine, and no activity for carnitine/acylcarnitines and other substrates tested .

  • Kinetic parameters: Determine transport affinities (Km) and maximum transport rates (Vmax) for key substrates. SLC25A29 has Km values of approximately 0.54 mM for arginine and 0.84 mM for lysine .

  • Transport mechanisms: Evaluate both exchange and uniport capabilities. Unlike most mitochondrial carriers that function as obligatory exchangers, SLC25A29 can catalyze substantial uniport besides exchange transport .

  • Inhibitor sensitivity: Test sensitivity to known inhibitors of mitochondrial carriers. SLC25A29 is inhibited by pyridoxal 5′-phosphate and mercuric compounds .

  • Control experiments: Include parallel experiments with well-characterized related carriers (e.g., SLC25A20, the established carnitine/acylcarnitine carrier) to highlight differences .

What controls are essential when assessing SLC25A29 transport activity?

Essential controls for SLC25A29 transport experiments include:

  • Negative controls:

    • Pure liposomes without incorporated protein

    • Proteoliposomes with boiled/denatured SLC25A29

    • Proteoliposomes with unrelated mitochondrial carriers (e.g., AGC1, Sam5p)

    • Bacterial cells containing the expression vector without the SLC25A29 coding sequence

  • Positive controls:

    • Well-characterized mitochondrial carriers with known substrate specificities (e.g., SLC25A20 for carnitine transport, SLC25A24 for phosphate transport)

  • Inhibitor controls:

    • Addition of transport inhibitors (pyridoxal 5′-phosphate and HgCl₂) at the beginning of the experiment rather than at the end

  • Time course controls:

    • Measurement of transport at multiple time points to ensure linearity in initial rate determinations

    • Extended incubation periods for substrates with potentially low transport rates

These controls help validate the specificity of observed transport activities and rule out artifacts or non-specific membrane leakage.

How should researchers interpret contradictory results regarding SLC25A29 substrate specificity?

When faced with contradictory results regarding SLC25A29 substrate specificity, researchers should consider:

  • Methodological differences: Earlier studies reporting carnitine/acylcarnitine transport used different experimental systems and potentially less direct measurement techniques compared to the reconstituted liposome system with purified protein .

  • Concentration effects: The research shows that at high concentrations (10 mM), intraliposomal carnitine may interact with SLC25A29, slightly increasing arginine uptake, which could be misinterpreted as carnitine transport .

  • Sensitivity thresholds: Earlier studies may have detected very low transport activities that were mistakenly attributed to physiologically relevant function. Direct comparative measurements with established substrates and appropriate controls are essential .

  • Indirect vs. direct evidence: Rescue experiments in cell systems (as used to propose ornithine transport) provide indirect evidence that may be influenced by secondary effects, whereas direct transport measurements with purified protein provide more definitive evidence of substrate specificity .

  • Transport mechanism considerations: Distinguishing between exchange, uniport, and potential substrate-stimulated transport is crucial for accurate interpretation .

When reconciling contradictory findings, researchers should prioritize results from comprehensive biochemical characterization using multiple complementary approaches with appropriate controls.

What is the physiological significance of SLC25A29's substrate specificity?

The substrate specificity of SLC25A29 for basic amino acids, particularly arginine and lysine, has important physiological implications:

  • Mitochondrial protein synthesis: Arginine and lysine are essential components of mitochondrial proteins. By importing these amino acids into mitochondria, SLC25A29 supports mitochondrial protein synthesis .

  • Amino acid degradation: Basic amino acids undergo catabolism in mitochondria. SLC25A29 facilitates this process by enabling the entry of these amino acids into the mitochondrial matrix .

  • Metabolic regulation: The expression of SLC25A29 is induced after partial hepatectomy or fasting, suggesting a role in metabolic adaptation .

  • Tissue-specific functions: SLC25A29 is expressed in several tissues, including heart, brain, liver, and kidney, indicating potentially important roles in these organs' mitochondrial function .

Understanding the physiological role of SLC25A29 is crucial for interpreting its potential involvement in pathological conditions and for designing targeted interventions that might modulate its activity.

How does SLC25A29 compare to other characterized mitochondrial amino acid transporters?

SLC25A29 belongs to a subset of mitochondrial carriers involved in amino acid transport, but has distinct characteristics:

  • Substrate specificity: SLC25A29 primarily transports basic amino acids (arginine, lysine), distinguishing it from other mitochondrial carriers that transport acidic amino acids (e.g., glutamate carrier) or neutral amino acids .

  • Transport mechanism: Unlike most mitochondrial carriers that function exclusively as exchangers, SLC25A29 can catalyze both exchange and uniport transport, sharing this characteristic with only a few other carriers (phosphate, glutamate, and carnitine/acylcarnitine carriers) .

  • Kinetic properties: SLC25A29 exhibits high-affinity transport for its preferred substrates (Km values in the submillimolar range), indicating efficient transport at physiological concentrations .

  • Specific activity: The specific activity of reconstituted SLC25A29 is comparable to the activities of other SLC25 proteins, suggesting similar transport capacities on a per-protein basis .

These distinctions highlight the specialized role of SLC25A29 in mitochondrial amino acid metabolism and underscore the importance of characterizing individual carriers within the SLC25 family.

What experimental approaches can be used to study SLC25A29 function in cellular systems?

Several experimental approaches can be employed to study SLC25A29 function in cellular systems:

  • Gene knockdown/knockout: Using siRNA, CRISPR-Cas9, or other genetic tools to reduce or eliminate SLC25A29 expression, followed by assessment of:

    • Mitochondrial protein synthesis rates

    • Basic amino acid metabolism

    • Mitochondrial function and morphology

  • Overexpression studies: Expressing wild-type or mutated SLC25A29 in cell lines to:

    • Rescue phenotypes in cells with deficient SLC25A29

    • Assess the impact of increased SLC25A29 activity on mitochondrial function

    • Study the effects of specific mutations on transport activity

  • Metabolic flux analysis: Using isotope-labeled amino acids to track their uptake into mitochondria and subsequent metabolism in the presence or absence of functional SLC25A29

  • Mitochondrial isolation and transport assays: Isolating mitochondria from cells with modified SLC25A29 expression and measuring uptake of radiolabeled substrates

  • Functional complementation: Testing whether SLC25A29 can complement defects in other basic amino acid transporters, as has been done with ornithine transporters in HHH syndrome fibroblasts

These approaches can provide insights into the physiological role of SLC25A29 in different cellular contexts and tissue types.

How can structural studies enhance our understanding of SLC25A29 substrate specificity?

Structural studies of SLC25A29 could significantly advance our understanding of its substrate specificity through:

Structural insights would complement the biochemical characterization and provide a framework for understanding how SLC25A29 achieves its substrate specificity and transport mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.