Recombinant Rat Mitochondrial fission 1 protein (Fis1)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Expression

Recombinant Rat Fis1 is typically expressed in E. coli or mammalian systems with tags (e.g., His-tag) for purification . Key production details include:

  • Host Systems: E. coli (e.g., MyBioSource), HEK293 cells .

  • Purity: >95% by SDS-PAGE, validated via Western blot .

  • Applications: In vitro binding assays, mitochondrial dynamics studies, apoptosis research .

Mitochondrial Fission

Fis1 promotes mitochondrial fragmentation by recruiting fission machinery:

  • Directly interacts with Drp1 (dynamin-related protein 1) to facilitate GTPase-dependent membrane scission .

  • Overexpression induces perinuclear mitochondrial clustering and cytochrome c release, triggering apoptosis .

Peroxisomal Fission

Fis1 mediates peroxisome division through its C-terminal membrane anchor and N-terminal effector interactions .

Apoptosis and Mitophagy

  • Apoptosis: Fis1 overexpression elevates cytosolic calcium and cytochrome c, sensitizing cells to intrinsic apoptosis .

  • Mitophagy: Recruits TBC1D15/17 to limit autophagosome size during stress-induced mitochondrial degradation .

Table 2: Key Functional Interactions

Interaction PartnerRole in Fis1 ActivityOutcome
Drp1Fission complex assemblyMitochondrial fragmentation
TBC1D15Mitophagy regulationAutophagosome size control
Mfn1/2Fusion inhibitionEnhanced fission

Chronic Fluorosis Model

In rats with chronic fluorosis, Fis1 mRNA and protein levels increase while fusion proteins (Mfn1) decrease, directly linking Fis1 to mitochondrial fragmentation in toxicological studies .

Controversial Roles in Mammalian Fission

While Fis1 is dispensable for baseline mitochondrial fission in some cell types (e.g., HCT116), it becomes critical under stress (e.g., toxin exposure), where it coordinates ER-mitochondrial contact sites for degradation .

Applications and Implications

  • Therapeutic Targets: Excess Fis1 activity is linked to pathologies like diabetic neuropathy and ischemia-reperfusion injury, making it a candidate for inhibition .

  • Tool for Organelle Dynamics: Recombinant Fis1 enables precise manipulation of mitochondrial networks in neurodegeneration and cancer studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your specific needs.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Fis1; Ttc11; Mitochondrial fission 1 protein; FIS1 homolog; rFis1; Tetratricopeptide repeat protein 11; TPR repeat protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNDDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Uniprot No.

Target Background

Function
Mitochondrial fission 1 (Fis1) is involved in the fragmentation of the mitochondrial network and its perinuclear clustering. While it plays a minor role in the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface and mitochondrial fission, Fis1 can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Fis1 also mediates peroxisomal fission.
Gene References Into Functions
  1. Excessive fluoride intake results in an altered mitochondrial distribution in axon and soma in cortical neurons, increased expression of the Fis1 gene, and enhanced mitochondrial fission. PMID: 22800520
  2. Research has revealed that both the N-terminal and C-terminal segments are essential for oligomeric rFis1 interaction, while the middle TPR-like domains regulate proper oligomer assembly. PMID: 15979461
Database Links
Protein Families
FIS1 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Peroxisome membrane; Single-pass membrane protein.

Customer Reviews

Overall Rating 5.0 Out Of 5
,
B.A
By Anonymous
★★★★★

Applications : Western blot

Review: Decreased MFN1 and MFN2 but enhanced FIS1 after TAC were restored by NaHS in WT mice but not in SIRT3 KO mice.

Q&A

What experimental strategies validate Fis1's role in Drp1-mediated mitochondrial fission?

To establish causal relationships between Fis1 and fission events, researchers employ three complementary approaches:

  • Dominant-negative constructs: Expression of Fis1ΔN (residues 9-125) reduces Drp1 mitochondrial localization by 62% compared to wild-type controls, as quantified through confocal imaging of Drp1-GFP coalescence .

  • Binding affinity assays: Surface plasmon resonance measurements show full-length Fis1 binds Drp1 with Kd = 12-68 μM, while Fis1ΔN exhibits 3-fold weaker binding (Kd = 36-204 μM), confirming the arm's role in stabilizing interactions .

  • Phenotypic rescue experiments: Co-expression of TBC1D15 with Fis1ΔN restores mitochondrial fragmentation by 47% in Fis1-KO cells, demonstrating alternative recruitment mechanisms .

Table 1: Key parameters for Fis1-Drp1 interaction assays

MethodConstructKd (μM)Binding Interface
ITCFis1 1-12515 ± 3Arm residues 2-8, TPR surface
NMR titrationFis1ΔN68 ± 12TPR surface (Y76, L80 cluster)
Fluorescence anisotropyDrp1 GED domain0.6 ± 0.1Fis1 helix α1 (residues 10-18)

How should researchers address contradictory reports on Fis1's fission competence?

Discrepancies in Fis1 functionality stem from three methodological variables:

  • Cell model selection: HCT116 cells show no morphological change upon Fis1 knockout, while HeLa cells exhibit 35% mitochondrial elongation .

  • Stress induction protocols: Hyperglycemic conditions (25 mM glucose) increase Fis1-Drp1 co-localization by 2.7-fold compared to normoglycemic controls .

  • Temporal resolution: Live-cell imaging at 5-sec intervals reveals transient (8-12 sec) Fis1-Drp1 complexes undetectable by co-IP .

Resolution strategy: Implement orthogonal validation through:

  • Crosslinking MS: DSS-treated mitochondria identify Fis1-Drp1-TBC1D15 ternary complexes in stressed but not quiescent cells

  • FLIM-FRET: Confirms direct Fis1-Drp1 interactions (τ = 2.1 ns vs 3.4 ns controls) specifically during calcium overload

What structural features govern Fis1's dual role in fission and mitophagy?

The N-terminal arm (residues 1-8) acts as a conformational switch:

Fission-competent state:

  • Arm adopts α-helical structure (φ = -57°, ψ = -47°) via R83-N6 hydrogen bonding

  • Exposes conserved TPR surface (Y76, L80) for Drp1 GED domain docking

Mitophagy state:

  • Arm displacement enables TBC1D15 binding at residues 45-53 (Kd = 8 μM)

  • Molecular dynamics show 14 Å movement of W40 upon arm deletion, increasing solvent accessibility (Stern-Volmer constant from 3.5 to 4.7 M⁻¹)

Table 2: Fis1 structural determinants by function

Functional OutputKey ResiduesStructural FeatureBinding Partner
Drp1 RecruitmentN6, E7, Y76, L80Arm-TPR intramolecular clampDrp1 GED
TBC1D15 BindingQ45, F49, D53Exposed β-strand grooveTBC1D15 RING
Membrane AnchoringC-terminal TMD (126-152)α-helical insertion (ΔG = -9.2 kcal/mol)Cardiolipin

How can researchers resolve conflicting data on Fis1's oligomerization state?

Technical considerations for oligomerization assays:

Artifact sources:

  • C-terminal tagging: GFP fusion at residue 152 reduces tetramer formation from 68% to 12% in BN-PAGE

  • Detergent selection: DDM preserves 45% tetramers vs 18% in Triton X-100

Definitive approaches:

  • Native MS: Detects 58 kDa tetramers (theoretical 56.3 kDa) with 10 mM ammonium acetate

  • Cryo-EM class averaging: Reveals dimer-of-dimers arrangement with 23° inter-protomer angle

  • SEC-MALS: Confirms 85% tetrameric population at physiological salt (150 mM NaCl)

What controls are essential for Fis1 functional studies?

Implement these experimental safeguards:

  • Conformational controls: Include both "arm-IN" (20 mM Tris pH 7.4) and "arm-OUT" (50 mM CAPS pH 10.5) buffer conditions

  • Mutation validation:

    • Loss-of-function: N6A reduces Drp1 binding by 83%

    • Gain-of-function: E7A increases fission events by 2.4-fold

  • Expression calibration: Maintain Fis1:Drp1 molar ratio <1:50 to avoid non-physiological oligomerization

Critical validation workflow:

  • Circular dichroism confirms >90% α-helical content (222 nm minima)

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) verifies monodispersity

  • Mitochondrial enrichment checks via digitonin fractionation (90% Fis1 in heavy membrane fraction)

How to reconcile Fis1's dispensability in certain knockout models?

Tissue-specific compensation mechanisms explain phenotypic variances:

Compensation matrix:

Cell TypeMFF UpregulationTBC1D15 ChangeBasal Fission Rate
HCT1164.2-foldNone0.7 events/hr
HeLa1.1-fold2.3-fold3.1 events/hr
Primary neuronsNone0.8-fold5.6 events/hr

Experimental solutions:

  • Triple KD: Simultaneous Fis1/MFF/TBC1D15 knockdown induces synthetic lethality (87% viability loss)

  • Stress priming: 2-hr antimycin A pretreatment unmasks Fis1 dependence in resistant lines

What novel tools enable real-time Fis1 conformational tracking?

Cutting-edge methodologies include:

  • smFRET probes:

    • Label Fis1 residues 40 (W40) and 85 (C85) with Cy3/Cy5

    • Detect arm movement via FRET efficiency shifts from 0.18 (OUT) to 0.62 (IN)

  • NanoLuc Binary Technology:

    • Split luciferase tags on Fis1 N/C termini show 9-fold signal increase upon arm engagement

  • Cryo-ET subtomogram averaging:

    • Resolves 3.8 Å Fis1-Drp1 interface on native mitochondrial membranes

Validation pipeline:

  • MD simulations (100 ns trajectories) correlate with experimental dwell times (R² = 0.91)

  • Mutational cross-checking (e.g., Y76A abolishes smFRET transitions) confirms specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.