Recombinant Rat Mitochondrial glutamate carrier 2 (Slc25a18)

Shipped with Ice Packs
In Stock

Description

Production and Validation

This recombinant protein is synthesized via codon-optimized expression in E. coli, followed by affinity chromatography using the His tag . Quality control measures include:

  • Purity assessment: SDS-PAGE confirms >90% homogeneity .

  • Activity validation: Functional assays measure glutamate transport kinetics, with a reported K<sub>m</sub> of ~0.26 mM for glutamate, indicating high substrate affinity .

  • Stability: Lyophilization with trehalose preserves long-term activity, though repeated freeze-thaw cycles are discouraged .

Functional Role in Mitochondrial Glutamate Transport

Slc25a18 (GC2) operates as a glutamate/H+ symporter, importing glutamate into the mitochondrial matrix for metabolism via glutamate dehydrogenase . Key functional distinctions from its isoform GC1 (Slc25a22) include:

FeatureGC2 (Slc25a18)GC1 (Slc25a22)
K<sub>m</sub> (glutamate)0.26 mM5 mM
Tissue DistributionPredominantly brain, testisLiver, pancreas, skeletal muscle
Transport DependencyΔpH-drivenΔpH-driven

GC2’s high affinity makes it critical in tissues with low extracellular glutamate, such as neurons, where it supports neurotransmitter synthesis and ammonia detoxification .

Research Applications

  • Metabolic Studies: Used to dissect glutamate’s role in the urea cycle and glutathione synthesis .

  • Neurological Disorders: Linked to epileptic encephalopathy when mutated; recombinant GC2 enables in vitro modeling of transport defects .

  • Drug Screening: Serves as a target for inhibitors like bathophenanthroline and tannic acid .

  • Structural Biology: Aids in resolving transport mechanisms of SLC25 carriers, including gating by salt-bridge networks .

Comparative Insights from Recombinant Models

Recombinant Slc25a18 has clarified evolutionary conservation across species:

  • Human homolog: 85% sequence identity, with analogous glutamate symport activity .

  • Mouse homolog: Used in models of cerebral hypomyelination and motor dysfunction .

Limitations and Future Directions

While recombinant Slc25a18 provides high purity and activity, its in vitro kinetics may differ from in vivo conditions due to membrane lipid composition effects . Future studies could integrate lipid bilayer systems to mimic native mitochondrial environments.

Product Specs

Buffer
The default storage buffer for liquid delivery form is Tris/PBS-based buffer containing 5%-50% glycerol. For lyophilized powder, the buffer used before lyophilization is Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We generally ship the format that is currently in stock. If you have specific requirements for the delivery form, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-320aa
Mol. Weight
35.7 kDa
Protein Length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cancer
Source
in vitro E.coli expression system
Species
Rattus norvegicus (Rat)
Target Names
Slc25a18
Target Protein Sequence
MIACRMSSQDLSITAKLINGGIAGLVGVTCVFPIDLAKTRLQNQQGKDVYKGMTDCLVKTARAEGFLGMYRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGICQVVITCPMEMLKIQLQDAGRLAVCQQASASATPTSRPYSTGSTSTHRRPSATLIAWELLRTQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQLGVSELTGKASFTHSFVAGCAAGSVSAVAVTPLDVLKTRIQTLKKGLGEDTYRGVTDCARKLWTQEGAAAFMKGAGCRALVIAPLFGIAQGVYFIGIGERILKCFE-
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Mitochondrial glutamate carrier 2 (Slc25a18) is involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H+.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Slc25a18 and what is its primary function in mitochondria?

Slc25a18, also known as GC2 (Glutamate Carrier 2), is one of two dedicated glutamate carriers in the inner mitochondrial membrane. Its primary function is to transport glutamate along with H⁺ into the mitochondrial matrix. This transport is dependent on the chemical component of the protonmotive force (ΔpH). Once in the matrix, glutamate serves as a substrate for mitochondrial glutamate dehydrogenase, which converts glutamate into oxoglutarate and NH₄⁺, a process important for the urea cycle and other metabolic pathways .

The transport mechanism involves:

  • Facilitation of glutamate import into mitochondria

  • Co-transport with H⁺

  • Dependence on protonmotive force

  • Contribution to glutamate homeostasis between cytosolic and mitochondrial compartments

How does Slc25a18 differ from Slc25a22 in structure and function?

While Slc25a18 (GC2) and Slc25a22 (GC1) share high homology (63% identity), they exhibit important functional differences:

ParameterSlc25a18 (GC2)Slc25a22 (GC1)
Kinetic propertiesLower Km and VmaxHigher Km and Vmax
Tissue expressionMore restrictedHigher expression in most tissues
Pathological associationsLess documentedLinked to epilepsy disorders
Functional redundancyLimited compensation for GC1Limited compensation for GC2

What is the tissue distribution pattern of Slc25a18 in mammalian systems?

Slc25a18 (GC2) shows a more restricted tissue distribution compared to Slc25a22 (GC1). While GC1 is expressed at higher levels in most tissues (particularly liver, pancreas, and spleen), GC2 demonstrates a more specialized expression pattern .

In neural tissues, the expression pattern is noteworthy:

  • In astrocytes, GC2 is typically more highly expressed than GC1

  • This contrasts with the general pattern observed in other tissues

  • This cell-specific expression suggests specialized functions in neural glutamate metabolism

Understanding this differential expression is crucial when designing tissue-specific studies or interpreting knockdown/knockout experimental results.

What are the known inhibitors of Slc25a18 and their mechanisms of action?

Several compounds inhibit Slc25a18 activity:

InhibitorMechanismSpecificityResearch Application
Pyridoxal 5'-phosphate (PLP)Interaction with lysine residuesInhibits both GC1 and GC2Used in carrier function studies
BathophenanthrolineMetal chelatorInhibits both GC1 and GC2Used in transport mechanism studies
Tannic acidMultiple binding sitesInhibits both GC1 and GC2Used in reconstitution experiments
MercurialsThiol reactivityAffects multiple carriersLess selective inhibition
SpermineUnclear mechanismAffects multiple carriersUsed in comparative studies

What are the most effective methods for measuring Slc25a18 activity in experimental systems?

Measuring Slc25a18 activity requires specialized techniques that assess mitochondrial glutamate transport:

Reconstituted Liposome Transport Assays:
The gold standard involves measuring [¹⁴C]glutamate/glutamate exchange in liposomes reconstituted with mitochondrial extracts. This approach directly quantifies carrier activity by tracking radioactive glutamate uptake. Typical values for control systems range from 35-40 nmol/mg of protein, while knockdown systems show reduced uptake (13-16 nmol/mg) .

NAD(P)H Fluorescence Measurement:
An indirect but valuable approach involves measuring NAD(P)H formation following glutamate transport and metabolism. This technique:

  • Utilizes changes in NAD(P)H fluorescence (typically 2-2.5% increase with glutamate stimulation)

  • Can differentiate between membrane transport and mitochondrial utilization when combined with specific inhibitors

  • Provides functional readouts of the metabolic consequences of glutamate transport

Control Measurements:
To ensure specificity, parallel measurements of aspartate/glutamate exchange (performed only by AGC carriers) should be conducted to differentiate between GC and AGC activity .

How can Slc25a18 expression be manipulated in experimental models?

Several approaches exist for manipulating Slc25a18 expression:

Lentiviral shRNA Knockdown:

  • Effective for generating stable cell lines with reduced Slc25a18 expression

  • Typical protocols involve co-transfection of 293T cells with lentiviral vectors containing Slc25a18-specific shRNAs and packaging plasmids (psPAX2, pMD2G)

  • Target cells are infected at a multiplicity of infection (MOI) of approximately 5

  • Expression reduction should be verified by RT-PCR and Western blotting after 48 hours

Overexpression Systems:

  • Lentiviral vectors containing the Slc25a18 coding sequence are effective

  • Cell lines like HCT116 and LOVO have been successfully used for overexpression studies

  • Expression increases should be confirmed at both mRNA and protein levels

Selection of Appropriate Cell Models:
When selecting cell models, consider:

  • Endogenous expression levels of Slc25a18 and related carriers

  • Tissue relevance to the biological question

  • Transfection/transduction efficiency

  • Ability to perform functional assays post-manipulation

What is the role of Slc25a18 in pathological conditions such as cancer?

Recent research has revealed important roles for Slc25a18 in cancer biology:

Colorectal Cancer:

  • Slc25a18 has demonstrated prognostic value in colorectal cancer

  • Increased Slc25a18 expression inhibits the Warburg effect (aerobic glycolysis) and cell proliferation via the Wnt/β-catenin cascade

  • These findings suggest Slc25a18 as a potential tumor suppressor in colorectal cancer

Metabolic Reprogramming:

  • Cancer cells often exhibit altered mitochondrial metabolism

  • Slc25a18 may influence this metabolic shift by regulating glutamate availability for the TCA cycle

  • Changes in Slc25a18 expression correlate with glycolysis and apoptosis content in tumors

Clinical Correlations:

  • Expression patterns of Slc25 family members (including Slc25a18) have been used to develop risk score models with prognostic value

  • High Slc25A5 expression, another family member, is an independent prognostic factor for better survival after surgical treatment

  • Tumor immune infiltration shows correlations with Slc25 family expression patterns

How does Slc25a18 interact with other mitochondrial carriers in the SLC25 family?

Slc25a18 functions within a complex network of mitochondrial carriers:

Functional Relationship with Slc25a22 (GC1):

  • Despite high homology, experimental evidence shows limited functional redundancy

  • Knockdown of one carrier is not effectively compensated by the other

  • This suggests distinct physiological roles despite similar transport mechanisms

Interactions with Aspartate/Glutamate Carriers (AGCs):

  • AGCs (Slc25a12, Slc25a13) also transport glutamate but primarily in exchange for aspartate

  • AGC1 and AGC2 are calcium-sensitive carriers with distinct tissue expression patterns

  • The glutamate/glutamate exchange performed by GCs is distinct from the aspartate/glutamate exchange performed by AGCs

Integrated Metabolic Networks:

  • Slc25a18 functions within broader metabolic pathways including:

    • The malate-aspartate shuttle (with AGCs)

    • Glutamate metabolism pathways

    • Mitochondrial energy production

    • Nitrogen metabolism and the urea cycle

What cellular mechanisms regulate Slc25a18 expression and activity?

Several mechanisms regulate Slc25a18 expression and activity:

Transcriptional Regulation:

  • Cell-type specific transcription factors influence Slc25a18 expression

  • Cancer-related transcriptional programs may alter Slc25a18 levels

  • GSEA analysis has identified pathways associated with Slc25a18 regulation

Post-translational Modifications:

  • Phosphorylation sites may influence carrier activity

  • Redox modifications can affect transport function

  • Protein-protein interactions may modulate carrier function

Metabolic Regulation:

  • Substrate availability affects transport activity

  • Energy status of the cell (ATP/ADP ratio) influences carrier function

  • Calcium signaling pathways indirectly affect glutamate transport through their effects on mitochondrial metabolism

What are the optimal conditions for expressing and purifying recombinant Slc25a18?

For successful expression and purification of recombinant Slc25a18:

Expression Systems:

  • Bacterial systems (E. coli): Challenging due to membrane protein nature but possible with specialized strains

  • Yeast systems (S. cerevisiae or P. pastoris): Better for functional expression

  • Mammalian cell systems: Most physiologically relevant but lower yield

Critical Parameters:

  • Express with C-terminal tags to avoid interfering with N-terminal import sequences

  • Include protease inhibitors during extraction and purification

  • Use mild detergents (DDM, LDAO) for solubilization

  • Perform functional validation of purified protein in reconstituted systems

Reconstitution Protocol:

  • Purify mitochondria from expression system

  • Extract with appropriate detergent

  • Purify carrier protein using affinity chromatography

  • Reconstitute into liposomes for functional assays

  • Validate transport activity using [¹⁴C]glutamate/glutamate exchange assays

How can researchers distinguish between Slc25a18 (GC2) and Slc25a22 (GC1) activities in experimental systems?

Distinguishing between GC1 and GC2 activities requires specialized approaches:

Kinetic Differentiation:

  • GC2 has lower Km and Vmax values compared to GC1

  • Performing transport assays at different substrate concentrations can help differentiate the carriers

  • Analysis of transport kinetics using Lineweaver-Burk or Eadie-Hofstee plots can reveal which carrier is predominant

Genetic Approaches:

  • Selective knockdown or knockout of each carrier

  • Specific RT-PCR primers can distinguish between the transcripts:

    • Slc25a18 forward: 5'-GTGTTCCCCATCGACTTGG-3'

    • Slc25a18 reverse: 5'-CACGACCTGGCACATCCC-3'

Tissue Source Selection:

  • Choose tissues or cell types with known differential expression

  • Astrocytes express more GC2 than GC1

  • Liver and pancreatic cells express more GC1 than GC2

Control Experiments:

  • Parallel measurement of aspartate/glutamate exchange (performed only by AGC carriers)

  • Comparison with known standards of each carrier

  • Use of tissues from knockout models as negative controls

What controls should be included when studying Slc25a18 knockdown or overexpression effects?

When manipulating Slc25a18 expression, include these essential controls:

For Knockdown Studies:

  • Negative controls:

    • Non-targeting shRNA/siRNA with similar GC content

    • Empty vector controls

    • Mismatched shRNA controls that differ from the target sequence by a few nucleotides

  • Validation controls:

    • RT-PCR to confirm transcript reduction

    • Western blot to confirm protein reduction

    • Functional assays to confirm reduced glutamate transport activity

  • Specificity controls:

    • Monitor expression of related carriers (GC1, AGCs)

    • Perform rescue experiments with RNAi-resistant constructs

    • Measure alternative transport pathways to detect compensation

For Overexpression Studies:

  • Expression controls:

    • Empty vector controls

    • Irrelevant protein overexpression controls

    • Expression level quantification by Western blot

  • Functional validation:

    • Measure increased glutamate transport activity

    • Assess downstream metabolic effects

    • Evaluate phenotypic changes with appropriate controls

Technical Controls:

  • Include multiple independent clones/lines

  • Perform dose-response studies where applicable

  • Include time-course analyses to detect adaptive responses

What methodologies are recommended for analyzing Slc25a18 expression in tissue samples?

For analyzing Slc25a18 expression in tissue samples:

RNA Level Analysis:

  • RT-PCR with specific primers is the most common approach:

    • Slc25a18 forward: 5'-GTGTTCCCCATCGACTTGG-3'

    • Slc25a18 reverse: 5'-CACGACCTGGCACATCCC-3'

    • GAPDH forward: 5'-AATCCCATCACCATCTTC-3'

    • GAPDH reverse: 5'-AGGCTGTTGTCATACTTC-3'

  • Calculate relative expression using the ΔCT method (2^-ΔCT) with GAPDH as endogenous control

Protein Level Analysis:

  • Immunohistochemistry with specific antibodies

  • Scoring system for quantification:

    • Intensity: "negative" = 0; "weak" = 1; "moderate" = 2; "strong" = 3

    • Percentage of positive cells: 0% = 0, 1-24% = 1; 25-50% = 2; 51-75% = 3; 76-100% = 4

    • Final score = intensity × percentage

    • Low expression defined as score ≤ 6, high expression as score > 6

Digital Analysis Methods:

  • Take images of high cellularity areas

  • Evaluate by color deconvolution with ImageJ software

  • Quantify cytoplasmic staining specifically

  • Perform statistical analysis on multiple samples

How should researchers interpret changes in Slc25a18 expression in the context of metabolic studies?

Interpreting Slc25a18 expression changes requires consideration of several factors:

Metabolic Pathway Integration:

  • Changes in Slc25a18 expression affect glutamate availability in the mitochondrial matrix

  • This impacts TCA cycle function through α-ketoglutarate production

  • Effects on NADH/NAD+ ratios may disrupt urea cycle metabolism

  • Altered cytosolic glutamate levels affect various cellular processes

Cancer Metabolism Context:

  • In colorectal cancer, Slc25a18 upregulation is associated with:

    • Decreased Warburg effect (less aerobic glycolysis)

    • Increased mitochondrial respiration

    • Enhanced programmed cell death

    • Inhibition of the MAPK and Wnt/β-catenin signaling pathways

Interpretation Guidelines:

  • Always correlate expression changes with functional measures of transport

  • Consider compensatory changes in related carriers

  • Evaluate downstream metabolic pathways

  • Associate findings with broader physiological or pathological contexts

What experimental issues commonly arise when working with Slc25a18 and how can they be resolved?

Common experimental challenges and solutions:

Challenge 1: Low Expression Levels

  • Solution: Optimize codon usage for expression system

  • Use stronger promoters for expression constructs

  • Consider tissue-specific expression systems

  • Validate antibodies carefully for specificity

Challenge 2: Functional Redundancy with Other Carriers

  • Solution: Design experiments to differentiate between carrier activities

  • Use selective knockdown approaches

  • Perform kinetic analyses to distinguish carrier contributions

  • Use tissues with differential expression patterns

Challenge 3: Reconstitution Difficulties

  • Solution: Optimize detergent selection for solubilization

  • Carefully control lipid composition in reconstituted liposomes

  • Monitor protein orientation in liposomes

  • Include functional controls in transport assays

Challenge 4: Inconsistent Knockdown Results

  • Solution: Test multiple shRNA/siRNA sequences

  • Validate knockdown at both RNA and protein levels

  • Include appropriate controls (mismatched shRNA)

  • Consider stable versus transient knockdown approaches

How can researchers analyze contradictory data regarding Slc25a18 function in different experimental systems?

When facing contradictory results:

Systematic Analysis Approach:

  • Compare experimental conditions:

    • Different cell types may have different basal expression levels

    • Growth conditions affect metabolic states and carrier activity

    • Media composition (especially glutamine/glutamate content) impacts results

  • Evaluate methodology differences:

    • Direct transport assays vs. indirect metabolic measurements

    • Acute vs. chronic manipulation of expression

    • In vitro vs. in vivo systems

  • Consider compensatory mechanisms:

    • Long-term knockdown may induce compensatory expression of other carriers

    • Metabolic adaptations may mask initial phenotypes

    • Cell-type specific regulation may explain differences

Resolution Strategies:

  • Perform side-by-side comparisons in multiple systems

  • Use multiple complementary approaches to measure the same parameter

  • Conduct time-course studies to distinguish primary from secondary effects

  • Apply systems biology approaches to model complex interactions

What are the latest bioinformatic tools for analyzing Slc25a18 expression and function in large datasets?

Current bioinformatic approaches include:

Gene Set Enrichment Analysis (GSEA):

  • GSEA version 2.3.3 (http://www.broadinstitute.org/gsea/) can determine biological functions and signaling pathways associated with Slc25a18

  • Pre-defined gene sets from the Molecular Signatures Database (MSigDB) provide reference for analysis

  • Significance thresholds are determined by permutation analysis (1000 permutations)

  • False Discovery Rate (FDR) < 0.05 is considered significantly enriched

TCGA Data Analysis:

  • TCGAbiolinks package in R 3.6.1 can be used to examine clinical pathological characteristics

  • Differential expression analysis between tumor and normal tissues

  • Correlation with clinical outcomes and patient survival

  • Integration with mutation and copy number data

Risk Score Modeling:

  • LASSO regression and multivariate Cox regression can be used to build predictive models

  • Integration of multiple SLC25 family members improves predictive power

  • Models can identify phenotypes associated with tumor immune infiltration, glycolysis, and apoptosis content

Validation Approaches:

  • Cross-validation using multiple independent datasets (e.g., Gene Expression Omnibus)

  • Integration of in silico predictions with in vitro and in situ verification

  • Correlation of expression data with functional outcomes and clinical parameters

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.