Recombinant Rat Mitochondrial import inner membrane translocase subunit Tim17-A (Timm17a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Timm17a; Mimt17; Tim17; Tim17a; Timm17; Mitochondrial import inner membrane translocase subunit Tim17-A; Inner membrane preprotein translocase Tim17a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Timm17a
Target Protein Sequence
MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAP QLGGSFAVWGGLFSTIDCGMVQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGG ILLALIEGAGILLTRFASAQFPNGPQFAEDHSQLPSSQLPSSPFGDYRQYQ
Uniprot No.

Target Background

Function
Essential component of the TIM23 complex, which mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How do the transmembrane domains of TIMM17A contribute to its function?

TIMM17A's four transmembrane (TM) domains have functionally distinct roles in protein translocation:

  • TM1 and TM2: Involved in interaction with Tim23, a component of the translocation channel. Mutations in these regions impair the association between Tim17 and Tim23, affecting channel formation .

  • TM3: Critical for binding the import motor components. Mutations in this region compromise the association with the import motor of the presequence translocase .

  • TM4: Functions in cooperation with other domains for proper targeting and membrane integration .

  • Matrix-facing residues: Specific residues in the matrix-facing region, particularly a conserved arginine residue (R105 in yeast), are essential for binding Tim44, a component of the import motor .

These distinct functional roles suggest that TIMM17A serves as a bridge between the translocation channel and the import motor, guiding translocating proteins from the channel to the motor of the TIM23 complex .

What are the recommended methods for reconstituting and storing recombinant Rat TIMM17A protein?

For optimal reconstitution and storage of recombinant Rat TIMM17A protein:

  • Reconstitution procedure:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage

    • The recommended default final concentration of glycerol is 50%

  • Storage conditions:

    • Store at -20°C/-80°C for long-term storage

    • For working aliquots, store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

    • The shelf life is approximately 6 months for liquid form at -20°C/-80°C and 12 months for lyophilized form

  • Buffer conditions:

    • Typical storage buffers include Tris-based buffer with pH 8.0

    • Some formulations include 6% Trehalose or 50% glycerol for stability

Following these guidelines will help maintain the structural integrity and activity of the recombinant protein for experimental applications.

How can the functional activity of recombinant TIMM17A be assessed in experimental settings?

Several experimental approaches can be employed to assess the functional activity of recombinant TIMM17A:

  • Protein-protein interaction assays:

    • Co-immunoprecipitation: To assess interaction with other TIM complex components such as Tim23 and Tim44

    • Crosslinking assays: Using BPA (p-benzoylphenylalanine) introduced at specific positions to identify interaction partners upon UV activation

    • Pull-down assays: Using His-tagged TIMM17A to identify binding partners

  • Mitochondrial import assays:

    • Assessing the ability of recombinant TIMM17A to rescue import defects in TIMM17A-depleted mitochondria

    • In vitro reconstitution of protein translocation using purified components and radiolabeled precursor proteins

  • Complementation studies:

    • Testing whether recombinant TIMM17A can rescue growth defects in yeast Tim17 mutants

    • Functional complementation in TIMM17A-depleted mammalian cells

  • Structural analysis:

    • Using site-directed mutagenesis to assess the functional importance of specific residues or domains

    • Membrane integration analysis using alkaline extraction or protease protection assays

  • Cell cycle analysis:

    • Flow cytometry with PI cell cycle Kit to evaluate the impact of TIMM17A on cell cycle progression

    • Western blotting to detect correlations with cell cycle regulators like CDK1

These methods provide complementary approaches to validate the functional integrity of recombinant TIMM17A and its role in mitochondrial protein import.

How is TIMM17A expression correlated with cancer progression and prognosis?

TIMM17A has been implicated in cancer progression through multiple studies, with significant correlations between its expression levels and clinical outcomes:

This data suggests TIMM17A may serve as a potential diagnostic and prognostic biomarker in multiple cancer types, with mechanistic roles in accelerating cell cycle progression and enhancing cancer aggressiveness.

What role does TIMM17A play in mitochondrial genome maintenance?

The relationship between TIMM17A and mitochondrial DNA (mtDNA) maintenance has been investigated, revealing a complex interplay:

  • TIMM17A overexpression and mtDNA protection:

    • Overexpression of Tim17A in certain cellular contexts prevents mtDNA loss

    • In NT2 cybrid cells (which can lose their mtDNA), Tim17A overexpression protected against mtDNA depletion

    • This effect appears to be protective rather than enhancing, as Tim17A overexpression did not increase mtDNA copy number above normal levels in cells with intact mtDNA

  • TIMM17A depletion effects:

    • RNAi-mediated silencing of TIMM17A had only a slight effect on mtDNA copy number

    • Unlike ATAD3 RNAi (another mitochondrial protein), TIMM17A depletion did not affect mitochondrial nucleoid structure, size, or number

    • These data suggest TIMM17A is not normally required for mtDNA maintenance and is not a direct component of the mtDNA nucleoid

  • Mechanistic considerations:

    • The protective effect appears indirect rather than through direct interaction with mtDNA

    • TIMM17A's primary role in mitochondrial protein import may indirectly support functions required for mtDNA stability

    • The exact mechanism by which TIMM17A prevents mtDNA loss remains to be fully elucidated

These findings suggest that while TIMM17A is not directly involved in mtDNA maintenance under normal conditions, it may play a protective role under certain stress conditions or in specific cellular contexts where mtDNA stability is compromised.

How do the two human TIMM17 paralogs (TIMM17A and TIMM17B) differ in regulation and function?

The human genome encodes two TIMM17 paralogs, TIMM17A and TIMM17B, with distinct regulatory mechanisms and potentially different functional roles:

  • Differential stability and regulation:

    • TIMM17A is short-lived and readily degraded in response to unbalanced cellular homeostasis

    • TIMM17A is regulated by the YME1L protease, while both paralogs are stabilized by the prohibitin complex

    • OCIAD1 (ovarian cancer immunoreactive antigen domain-containing protein 1) specifically protects the TIMM17A variant from degradation by associating with the prohibitin complex

    • Interestingly, depletion of TIMM17B-containing TIM23 positively regulates OCIAD1 abundance, suggesting a compensatory mechanism

  • Regulatory proteins:

    • The prohibitin complex is critical for biogenesis of both TIMM17A- and TIMM17B-containing TIM23 translocases

    • OCIAD1 differentially controls the levels of both translocase variants, specifically protecting TIMM17A

    • This forms a regulatory axis that controls the levels of TIM23 complex variants in human cells

  • Functional distinctions:

    • While both paralogs are components of the TIM23 complex, data supporting significant functional differences are currently limited

    • The differential regulation suggests that the two variants may be important under different cellular conditions

    • TIMM17A's more dynamic regulation may allow for rapid adaptation to changing cellular needs

This regulatory distinction between TIMM17A and TIMM17B represents an area of ongoing research, with potential implications for understanding mitochondrial adaptation to stress conditions and in disease contexts.

What are the internal targeting signals (ITS) required for proper localization of TIMM17A to mitochondria?

The import of TIMM17A into mitochondria relies on internal targeting signals rather than classic N-terminal presequences. Research, particularly in the divergent eukaryote Trypanosoma brucei, has revealed critical insights about these signals:

  • Identified internal targeting signals (ITS):

    • At least two internal targeting signals are required:

      1. Within transmembrane domain 1 (TM1, residues 31-50)

      2. Within TM4 and loop 3 (residues 120-136)

    • Both signals are required for proper targeting and integration of Tim17 in the membrane

  • Critical residues:

    • A positively charged residue (K122 in T. brucei Tim17) is critical for mitochondrial localization

    • This is consistent with the importance of charged residues in mitochondrial protein targeting

  • Mechanistic insights:

    • Individual TM domains containing targeting signals can direct reporter proteins to mitochondria, but they remain soluble rather than being inserted into the inner membrane

    • Full-length Tim17 import likely requires cooperative interaction between signals in TM1 and TM4

    • The region between residues 130-142 appears essential for translocation through the outer mitochondrial membrane

    • Deletion of the C-terminal region beyond residue 136 hampers targeting and import

  • Comparison to yeast models:

    • In Saccharomyces cerevisiae, regions between the third and fourth TMs were initially proposed as import signals

    • Later studies found that pairs of TMs, particularly the first and fourth, are required for efficient import

    • This differs from T. brucei Tim17, where TM3-TM4 constructs were not targeted to mitochondria, suggesting different import mechanisms

These findings highlight the complex nature of internal targeting signals in multipass membrane proteins and suggest that TIMM17A import involves sequential interactions with translocase components rather than simple recognition of a linear sequence motif.

What experimental approaches can be used to study TIMM17A's role in the TIM23 complex assembly and regulation?

Advanced experimental approaches to investigate TIMM17A's role in TIM23 complex assembly and regulation include:

  • Structural and interaction studies:

    • Site-directed mutagenesis: Targeting specific residues in different TM domains to assess their contribution to complex formation and function

    • Crosslinking with unnatural amino acids: Incorporation of p-benzoylphenylalanine (BPA) at specific positions followed by UV activation to identify interaction partners

    • Blue native PAGE: To analyze intact complexes and subcomplexes containing TIMM17A

    • Cryo-electron microscopy: To determine the structural organization of the TIM23 complex

  • Dynamic regulation analysis:

    • Pulse-chase experiments: To study the turnover of TIMM17A under different cellular conditions

    • Protease inhibition studies: Using specific inhibitors of YME1L to assess TIMM17A degradation kinetics

    • Proximity labeling approaches: BioID or APEX2 fusions to identify the dynamic interactome of TIMM17A

    • Time-resolved proteomics: To assess changes in TIM23 complex composition under stress conditions

  • Functional assays:

    • Reconstitution in proteoliposomes: With purified components to assess channel formation and protein translocation

    • Electrophysiology: To measure channel activity of reconstituted TIM23 complexes with different TIMM17A variants

    • Import assays with recombinant precursors: To assess the efficiency of different substrate translocation

    • In vitro binding assays: Using purified domains to map interaction surfaces

  • Systems-level approaches:

    • Genome-wide CRISPR screens: To identify genetic interactions with TIMM17A

    • Proteomics after TIMM17A depletion: To assess global effects on mitochondrial protein composition

    • Metabolomics: To determine the impact of TIMM17A variants on mitochondrial metabolism

    • Gene Set Enrichment Analysis (GSEA): To identify pathways associated with TIMM17A expression or mutations

  • Disease-relevant models:

    • Patient-derived cell lines: To study TIMM17A regulation in disease contexts

    • Cancer cell panels: To correlate TIMM17A levels with cellular phenotypes

    • Tissue microarrays: For high-throughput analysis of TIMM17A expression in patient samples

These complementary approaches can provide insights into both the structural basis of TIMM17A function and its dynamic regulation in healthy and disease states.

How conserved is TIMM17A across different species and what does this tell us about its essential functions?

TIMM17A demonstrates significant evolutionary conservation across eukaryotic lineages, providing insights into its fundamental roles:

The high conservation of TIMM17A across diverse eukaryotic lineages underscores its fundamental importance in mitochondrial function while allowing for lineage-specific adaptations in regulation and complex assembly.

What methodological approaches are most effective for studying species-specific differences in TIMM17A function?

To effectively investigate species-specific differences in TIMM17A function, researchers can employ several complementary methodological approaches:

  • Comparative genomics and sequence analysis:

    • Multiple sequence alignment of TIMM17A homologues to identify conserved and divergent regions

    • Phylogenetic analysis to establish evolutionary relationships

    • Computational prediction of structural features and potential functional motifs

    • Analysis of selection pressure on different protein domains across species

  • Cross-species complementation studies:

    • Expression of TIMM17A homologues from different species in yeast or mammalian systems with endogenous TIMM17A deletion or depletion

    • Assessing the ability of homologues to rescue growth defects or import deficiencies

    • Creating chimeric proteins with domains from different species to map functional regions

  • Structural biology approaches:

    • Cryo-EM or X-ray crystallography of TIMM17A homologues from different species

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • NMR studies of isolated domains to assess structural differences

    • Molecular dynamics simulations to predict species-specific conformational changes

  • Biochemical and functional assays:

    • In vitro reconstitution of import complexes using purified components from different species

    • Import assays with mitochondria isolated from different organisms

    • Protein-protein interaction analysis to identify species-specific binding partners

    • Electrophysiological measurements of reconstituted channels

  • Cell biology approaches:

    • Live cell imaging of fluorescently tagged TIMM17A homologues in heterologous systems

    • Import assays using isolated mitochondria from different species

    • Assessment of mitochondrial morphology and function in cross-species complementation models

    • Electron microscopy to visualize ultrastructural differences in mitochondria

  • Systems biology integration:

    • Proteomics analysis of TIMM17A-associated complexes across species

    • Transcriptomics to identify co-regulated genes in different organisms

    • Metabolomics to assess differences in mitochondrial function

    • Network analysis to identify species-specific functional associations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.