Recombinant Rat Mitochondrial import inner membrane translocase subunit Tim21 (Timm21)

Shipped with Ice Packs
In Stock

Description

Introduction

The translocase of the inner mitochondrial membrane 21 (TIMM21) is a vital component of the mitochondrial protein import machinery . Specifically, it is involved in the translocation of proteins across the inner mitochondrial membrane . This article aims to provide a detailed overview of Recombinant Rat Mitochondrial import inner membrane translocase subunit Tim21 (Timm21), including its function, structure, and implications in various biological processes.

General Information

PropertyDescription
NameTranslocase of Inner Mitochondrial Membrane 21 (TIMM21)
FunctionProtein translocation across the mitochondrial inner membrane; assembly of respiratory chain Complex I and Complex IV
LocationMitochondrial inner membrane
HomologuesCOA1
RoleComponent of the TIM23 complex

Molecular Function and Structure

TIMM21 is a protein-coding gene. It participates in the import of proteins into the mitochondrial matrix, the assembly of mitochondrial cytochrome c oxidase, and the assembly of mitochondrial respiratory chain complex I .

TIMM21, along with Tim17, is involved in switching between a TIM23 complex that inserts proteins into the inner membrane and one that imports proteins into the matrix . Associations between proteins of the respiratory chain and the protein import apparatus have been observed .

The TIM22 complex, which includes Tim22, Tim29, AGK, and Tim chaperones (Tim9, Tim10a, and Tim10b), is responsible for importing hydrophobic carrier proteins into the inner membrane of mitochondria .

Role in Mitochondrial Protein Import

Mitochondria, essential for cellular metabolism and apoptosis, rely on the import of proteins synthesized in the cytosol . The TIM23 complex, which includes Tim17, Tim21, Tim23, and Tim50, sorts precursor proteins . Tim23 forms the channel across the inner membrane, and translocation requires the inner membrane electrochemical potential . Tim50 also promotes the closure of the Tim23 channel in the absence of precursor proteins .

Association with Respiratory Chain Complexes

Tim21-like proteins may associate with respiratory chain Complexes I and III, in addition to the TIM17:23 translocase . Yeast Tim21 has a physical association with components of the TIM17:23 complex and respiratory subunits of complexes III and IV . It plays a role in the import and insertion of proteins into the inner membrane, rather than in the translocation of matrix-located proteins .

Homology with COA1

TIMM21 is a distant homolog of COA1, with regions of substantial homology including the membrane-spanning domain . Both TIMM21 and COA1 play roles in the mitochondria and have comparable secondary structures .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
Timm21; Tim21; Mitochondrial import inner membrane translocase subunit Tim21; TIM21-like protein, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-245
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Timm21
Target Protein Sequence
LGRQLLLPHFVLTKACLKTQPLRWGLREQKKTVQPRTVLGFTQKTFWTQGPDPRKAKEDS SKQVSINRNQREETGVSTSQKVKEAGRDVTYLIVVLFGVSITGSLLYTIFKELFSSSSPN IIYGKALGKCRTHPEVISVFGEPVKGYGEMSRRGRRQHVSFTEYANNGLKRIRVKFYIEG SEPGKQGTVHAEVEENPRSGQFDFRYIFVDVAPKRSIVVEDNRFQQS
Uniprot No.

Target Background

Function
Tim21 participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It is also essential for the assembly of mitochondrial respiratory chain complex I and complex IV as a component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex). Tim21 likely shuttles between the presequence translocase and respiratory-chain assembly intermediates, facilitating the incorporation of early nuclear-encoded subunits into these complexes.
Database Links
Protein Families
TIM21 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is Mitochondrial Import Inner Membrane Translocase Subunit Tim21 (Timm21)?

Timm21 is a critical component of the mitochondrial protein import machinery, specifically functioning as a subunit of the TIM17:23 translocation complex. This protein plays a dynamic role in mitochondrial biogenesis and respiratory chain assembly. Timm21 has been identified as a key mediator in the sorting and organization of proteins targeted to the inner mitochondrial membrane. The protein exhibits multiple interaction capabilities, forming associations not only with components of the TIM complex but also with respiratory chain complexes, suggesting its multifunctional nature in mitochondrial biology . In rat models, the protein consists of 245 amino acids, with the mature form comprising residues 19-245, and is encoded by the Timm21 gene .

How does Timm21 contribute to mitochondrial function under normal physiological conditions?

Timm21 serves as a crucial link between protein import and respiratory chain assembly in mitochondria. Under normal physiological conditions, Timm21 functions by:

  • Mediating the translocation of nuclear-encoded proteins into the mitochondria through its association with the TIM17:23 complex

  • Promoting the insertion of proteins specifically targeted to the inner mitochondrial membrane, rather than matrix-destined proteins

  • Facilitating interactions between the protein import machinery and respiratory chain components (particularly Complex III and IV)

  • Contributing to the proper assembly and function of respiratory complexes, thereby supporting optimal ATP production

Research in various organisms has demonstrated that Timm21 is essential for maintenance of mitochondrial function, with deletion studies showing early seedling lethality in Arabidopsis, highlighting its critical role in eukaryotic cell function .

What is the mechanistic role of Timm21 in the protein import pathway?

Timm21 functions through a complex mechanistic pathway within mitochondrial protein import. Specifically, Timm21's association with the TIM17:23 complex forms what is known as the sorting and organization translocase (SORT) complex. This configuration promotes several critical functions:

  • Tethering of the import machinery to the outer membrane translocation pore, creating a continuous channel for protein import

  • Initiation of protein insertion into the inner membrane through specific recognition of targeting signals

  • Dynamic interaction with both the TOM complex of the outer membrane and respiratory chain components

  • Selective sorting of proteins destined for the inner membrane versus those targeted to the matrix

The molecular mechanism involves Timm21 serving as a dynamic adapter protein that can associate with and dissociate from the core TIM17:23 complex, thereby regulating the flux and selectivity of protein import. This mechanistic versatility appears to be conserved across species, though with important functional differences that reflect evolutionary adaptations .

How do Timm21 interactions with respiratory chain complexes influence mitochondrial bioenergetics?

Timm21 exhibits direct physical associations with components of respiratory chain complexes, particularly Complex III and Complex IV. These interactions create a functional link between protein import and respiratory chain assembly that influences mitochondrial bioenergetics in several ways:

  • Coordinating the assembly of newly imported respiratory chain subunits into their respective complexes

  • Enhancing the efficiency of respiratory complex formation by directing imported proteins to their appropriate assembly locations

  • Potentially regulating the activity of respiratory complexes in response to cellular energy demands

  • Supporting the formation of supercomplexes (e.g., Complex I and III associations)

Studies using overexpression models have demonstrated that increased Timm21 levels correlate with enhanced ATP production, increased cell size and number, and upregulation of transcripts encoding components of Complex III, Complex IV, and ATP synthase . This suggests that Timm21 plays a role beyond simple protein import and may function as a regulatory node linking mitochondrial protein import to respiratory chain activity and ATP production.

What is the potential significance of Timm21 in mitochondrial disease pathology?

Timm21's central role in mitochondrial protein import and respiratory chain assembly positions it as a potential factor in mitochondrial disease pathology. Research has identified several connections:

  • As a component of the TIM23 complex, Timm21-mediated protein sorting has been identified as a potential therapeutic target for ATP synthase disorders

  • Modulation of Timm21 activity or expression can improve phenotypes associated with ATP synthase deficiency, including biogenesis and activity of the oxidative phosphorylation machinery

  • Timm21 dysfunction may contribute to the pathogenesis of mitochondrial diseases characterized by impaired respiratory chain assembly and function

The therapeutic potential of targeting Timm21 and the TIM23 complex stems from its central role in mitochondrial biogenesis. By enhancing the efficiency of protein import and respiratory chain assembly, interventions targeting this pathway could potentially ameliorate the bioenergetic deficits characteristic of mitochondrial diseases .

What are the recommended protocols for reconstitution and storage of recombinant rat Timm21?

For optimal experimental outcomes when working with recombinant rat Timm21, the following protocol is recommended:

Reconstitution Protocol:

  • Briefly centrifuge the vial containing lyophilized Timm21 to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage)

  • Prepare multiple small aliquots to avoid repeated freeze-thaw cycles

Storage Recommendations:

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

  • Working aliquots may be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can compromise protein stability and function

  • Store in Tris/PBS-based buffer (pH 8.0) containing 6% Trehalose

Following these guidelines ensures the maintenance of protein integrity and biological activity, which is crucial for obtaining reliable experimental results when studying Timm21 function.

What experimental approaches can be used to investigate Timm21 interactions with other mitochondrial proteins?

Several complementary experimental approaches can be employed to investigate Timm21 interactions with other mitochondrial proteins:

Yeast Two-Hybrid Assays:
This approach allows for the detection of direct protein-protein interactions between Timm21 and potential binding partners. The method involves:

  • Cloning Timm21 into a bait vector and transforming into an appropriate yeast strain

  • Cloning potential interaction partners (e.g., TIM complex components, respiratory chain subunits) into prey vectors

  • Mating the transformed strains and selecting for positive interactions on selective media

  • Confirming interactions through growth on stringent selection media (e.g., quadruple dropout media)

Time-Course Import Assays:
This technique enables visualization of the dynamic incorporation of Timm21 into protein complexes:

  • In vitro translation and radiolabeling of Timm21 precursor protein

  • Incubation with isolated mitochondria for varying time periods

  • Isolation of mitochondria and analysis by blue native polyacrylamide gel electrophoresis (BN-PAGE)

  • Detection of Timm21 incorporation into complexes via autoradiography or phosphorimaging

Co-Immunoprecipitation:
This approach can confirm interactions in a more physiological context:

  • Preparation of mitochondrial lysates under conditions that preserve protein-protein interactions

  • Immunoprecipitation using antibodies against Timm21 or potential interaction partners

  • Western blot analysis to detect co-precipitated proteins

These methods, when used in combination, provide robust evidence for specific and biologically relevant interactions between Timm21 and other mitochondrial proteins.

How can researchers assess the functional impact of Timm21 on mitochondrial protein import and respiratory chain assembly?

Assessing the functional impact of Timm21 requires a multi-faceted experimental approach:

Genetic Manipulation Strategies:

  • Gene knockout/knockdown systems to reduce Timm21 expression

  • Overexpression systems to increase Timm21 levels

  • Site-directed mutagenesis to create Timm21 variants with altered functional domains

Functional Assays:

These approaches provide comprehensive insights into how Timm21 modulates mitochondrial bioenergetics through its dual role in protein import and respiratory chain assembly.

How do Tim21-like proteins compare to canonical Tim21 in structure and function?

Tim21-like proteins represent an interesting evolutionary adaptation of the Tim21 family with both structural similarities and functional divergences:

Structural Comparison:

FeatureCanonical Tim21Tim21-like Proteins
Predicted mitochondrial processing sitesPresentPresent
Transmembrane domainsOne conserved domainOne conserved domain
Tim21 conserved domainPresentPresent with variations
Sequence identity with yeast Tim21ModerateLower than canonical Tim21
Sequence similarity within familyReference30-45% similarity to canonical Tim21

Tim21-like proteins maintain the core structural features necessary for mitochondrial localization and membrane insertion, while exhibiting sufficient divergence to suggest specialized functions .

Functional Comparison:

  • Both canonical Tim21 and Tim21-like proteins interact with the TIM17:23 complex

  • Both can associate with respiratory chain components, particularly Complex III

  • Tim21-like proteins show some differential interaction patterns, with Tim21-like 2 exhibiting more extensive interactions than Tim21-like 1

  • Canonical Tim21 shows interactions with outer membrane components (TOM complex) that may not be conserved in all Tim21-like proteins

These comparative analyses suggest that Tim21-like proteins evolved to fulfill specialized roles in mitochondrial biogenesis while maintaining core functional interactions with the protein import machinery and respiratory chain components.

What are the species-specific differences in Tim21/Timm21 function across experimental models?

Significant species-specific differences in Tim21/Timm21 function have been observed across experimental models:

Yeast vs. Mammalian Systems:

  • In yeast, Tim21 is non-essential, with deletion mutants being viable

  • In contrast, Tim21 appears to be essential in higher eukaryotes, with deletion resulting in early seedling lethality in Arabidopsis

  • Yeast Tim21 functions primarily in protein sorting, while mammalian Timm21 may have expanded roles in respiratory chain assembly and regulation

Arabidopsis vs. Rat Models:

  • Arabidopsis contains multiple Tim21-like proteins (AtTim21, AtTim21-like 1, AtTim21-like 2) with partially overlapping functions

  • Rat and other mammals typically express a single canonical Timm21 protein

  • Overexpression of AtTim21 in Arabidopsis leads to increased cell numbers, cell size, and ATP production, suggesting a more direct role in growth regulation

These species-specific differences likely reflect evolutionary adaptations to different metabolic demands and mitochondrial functions across species. Understanding these differences is crucial for translating findings from model organisms to mammalian systems and for developing targeted therapeutic approaches for mitochondrial diseases.

How might modulation of Timm21 function be leveraged for treating mitochondrial diseases?

The modulation of Timm21 function represents a promising therapeutic strategy for mitochondrial diseases, particularly those affecting ATP synthase. Research indicates several potential approaches:

  • Enhancement of Protein Import Efficiency:

    • Upregulation of Timm21 expression could improve the import and assembly of nuclear-encoded mitochondrial proteins

    • This approach may be particularly beneficial in diseases characterized by deficient assembly of respiratory chain complexes

  • Targeting the TIM23 Complex:

    • The TIM23 complex, which includes Timm21, has been identified as a therapeutic intervention point for ATP synthase disorders

    • Modulating TIM23-dependent protein sorting improves various phenotypes associated with ATP synthase deficiency, including biogenesis and activity of the oxidative phosphorylation machinery

  • Small Molecule Modulators:

    • Screening drug repurposing libraries has identified compounds that can modulate mitochondrial protein sorting

    • These compounds may act by affecting Timm21's interactions with other components of the import machinery or respiratory complexes

The therapeutic potential of targeting Timm21 stems from its central role in mitochondrial biogenesis. By enhancing the efficiency of protein import and respiratory chain assembly, interventions targeting this pathway could potentially ameliorate the bioenergetic deficits characteristic of various mitochondrial diseases .

What experimental models are most appropriate for studying Timm21's role in mitochondrial disease?

Several experimental models have proven valuable for investigating Timm21's role in mitochondrial disease:

Yeast Models:

  • Advantages:

    • Genetic tractability allows easy manipulation of Tim21 and related proteins

    • Well-characterized mitochondrial protein import machinery

    • Rapid growth and screening capabilities

  • Limitations:

    • Tim21 is non-essential in yeast, unlike in higher eukaryotes

    • Differences in respiratory chain organization compared to mammals

Patient-Derived Cell Models:

  • Advantages:

    • Directly relevant to human disease

    • Preserve genetic background of the disease

    • Allow for personalized medicine approaches

  • Applications:

    • Testing therapeutic strategies targeting Timm21 and the TIM23 complex

    • Investigating the impact of Timm21 modulation on ATP synthase disorders

Arabidopsis Models:

  • Advantages:

    • Multiple Tim21-like proteins allow for studying functional redundancy

    • Tim21 is essential, similar to higher eukaryotes

    • Overexpression phenotypes provide insights into function

  • Limitations:

    • Plant-specific adaptations in mitochondrial function

The optimal approach involves integrating findings across these complementary model systems to develop a comprehensive understanding of Timm21's role in mitochondrial disease and to identify conserved pathways that can be therapeutically targeted.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.