Recombinant Rat Mitochondrial import inner membrane translocase subunit Tim23 (Timm23)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Mitochondrial Import Inner Membrane Translocase Subunit Tim23 (Timm23)

The Recombinant Rat Mitochondrial import inner membrane translocase subunit Tim23 (Timm23) is a vital component of the protein translocation machinery in mitochondria . Mitochondria, essential organelles in eukaryotic cells, rely on the import of almost all of their constituent proteins, which are synthesized in the cytosol, across their double-membrane envelope . The TIM23 complex, a conserved protein translocase, facilitates the import of presequence-containing proteins (preproteins) into the mitochondrial matrix and inner membrane .

Function and Structure of the TIM23 Complex

The TIM23 complex mediates the translocation of preproteins across and their insertion into the mitochondrial inner membrane . This complex is essential for mitochondrial biogenesis, as it imports the majority of proteins required for mitochondrial function from the cytosol .

Role of Individual Subunits

  • Tim23: Integral to the TIM23 complex, it is essential for the translocation of preproteins into mitochondria . It was initially believed to form part of the protein-conducting channel, but structural analysis suggests it has a structural role in the complex .

  • Tim17: Forms the protein translocation path within the TIM23 complex .

  • Tim50: Promotes the closure of the Tim23 channel in the absence of precursor proteins, allowing tight regulation .

  • Tim21: Modulates the activity of the TIM23 complex and is involved in the import of proteins into the matrix .

Interaction with Mutant Huntingtin (Htt)

Research indicates that mutant Huntingtin (Htt), associated with Huntington's disease (HD), interacts with the TIM23 complex, which inhibits protein import in isolated brain mitochondria . The N-terminal 17 amino acids (N17) of Htt are crucial for its subcellular localization and interaction with the TIM23 complex . Mutant Htt specifically associates with the Tim23 subunit . Inhibition of mitochondrial protein import by mutant Htt is an early pathogenic defect that leads to neuronal death .

TIMM50 and Its Impact on TIM23 Complex

TIMM50, another component, is also vital for the stability of the TIM23 core complex . Studies involving TIMM50 mutations in human fibroblasts have shown significant decreases in TIM23 core protein levels (TIMM50, TIMM17A/B, and TIMM23) . Deficiencies in TIMM50 can lead to declined respiration rates, reduced cellular ATP levels, and defective mitochondrial trafficking in neuronal processes, contributing to neurological defects .

Remodeling of the TIM23 Complex

The TIM23 complex undergoes active remodeling to sort preproteins into different mitochondrial subcompartments . Subunits like Tim21 and Pam17 modulate its activity, indicating that the TIM23 complex functions as a single structural and functional unit .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Timm23; Tim23; Mitochondrial import inner membrane translocase subunit Tim23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Timm23
Target Protein Sequence
MEGGGGSSNKSTGGLAGFFGAGGAGYSNADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEF ILPTGANKTRGRFELAFFTIGGCCMTGAAFGALNGLRLGLKETQSMPWSKPRNVQILNMV TRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDFNTVAAGTMTGMLYKCTGGLRGIARG GLAGLTLTSVYALYNNWEHMKGSLLQQSL
Uniprot No.

Target Background

Function

Essential component of the TIM23 complex, which mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.