Recombinant Rat Mitochondrial uncoupling protein 2 (Ucp2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ucp2; Slc25a8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLARTAASAQYR GVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTS PNVARNAIVNCTELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA AYESREAPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane. This uncoupling disrupts the normal coupling of oxidative phosphorylation to ATP synthesis, resulting in energy dissipation as heat.
Gene References Into Functions
  1. Studies have shown that UCP2 plays a neuroprotective role by inhibiting apoptotic factors and oxidative stress, thereby enhancing neuron survival following status epilepticus. PMID: 30159115
  2. Research suggests that atorvastatin effectively mitigates myocardial remodeling by downregulating UCP2 expression. This downregulation improves myocardial energy metabolism, inhibits myocardial hypertrophy, and ultimately reduces myocardial remodeling. PMID: 29559841
  3. Asiatic acid has been shown to possess obesity-alleviating properties and influences the expression of ACC1, UCP2, and CPT1 mRNA in high-fat diet-induced obese Sprague-Dawley rats. PMID: 28993954
  4. UCP2 is believed to inhibit myointimal hyperplasia following vascular injury by suppressing nuclear factor-kappaB-dependent smooth muscle cell proliferation and migration. PMID: 29025747
  5. microRNA-503 has been identified as a significant mediator of brain UCP2 downregulation. PMID: 28640254
  6. Research indicates that the UCP2 and NLR family-pyrin domain-containing 3/caspase 1/interleukin 1beta signaling pathway may be involved in intestinal barrier injury. Treatment with GIK has been shown to decrease intestinal barrier permeability. PMID: 28428961
  7. GLP-1 promotes the synthesis of GR and facilitates the translocation of the nuclear transcription factor erythroid 2p45-related factor (Nrf2). Glucose-stimulated insulin secretion is also preserved in beta-cells exposed to tert-BOOH but pretreated with GLP-1, potentially through the downregulation of UCP2. PMID: 26968794
  8. UCP2 exhibits an apoptotic effect in beta cells by regulating the intrinsic pathway of apoptosis in brain-dead organ donors. PMID: 28222054
  9. Observations suggest that downregulation of UCP2 expression in hypothermically preserved rat hearts partially initiates a protective mechanism through the SIRT1 pathway. PMID: 27356851
  10. Studies have revealed that UCP2 expression varies with age and the severity of obesity, supporting the prevalent notion that increased UCP2 expression is an adaptive response to heightened fatty acid beta-oxidation and reactive oxygen species production during obesity. PMID: 26621256
  11. In rats on a chronic alcohol diet, the lungs and spleen exhibited a significant increase in cytochrome c release from mitochondria. Notably, these organs did not display any alteration in UCP-2 gene and protein expression. PMID: 26664262
  12. The expression level of UCP2 is closely correlated with mitochondrial injury in a sepsis rat model. PMID: 26903064
  13. The iPLA2gamma/UCP2 synergy offers a feedback antioxidant mechanism that prevents oxidative stress induced by physiological fatty acid intake in pancreatic beta-cells, regulating glucose-, fatty acid-, and redox-stimulated insulin secretion. PMID: 25925080
  14. Data indicate that mitochondrial morphology and function are compromised in cardiomyocytes under septic conditions, and silencing of UCP2 using siRNA exacerbates this process. PMID: 25873251
  15. Manipulation of mitochondrial uncoupling protein-2 is proposed as a potential strategy for redirecting microglial response toward protective phenotypes. PMID: 26173855
  16. A study aimed to investigate the early changes in cardiac uncoupling protein-2 (UCP2) expression following myocardial ischemia-reperfusion in rats chronically treated with ramiprilat and losartan. PMID: 23372044
  17. Indoxyl sulfate-induced cardiomyocyte hypertrophy is partly attributed to the inhibition of AMPK/UCP2 signaling and the enhancement of oxidative stress. PMID: 25703824
  18. Vitamin D deficiency reduces adiposity in rats and causes altered expression of uncoupling proteins and steroid receptor coactivator 3. PMID: 25132457
  19. Chronic alcohol consumption leads to a cerebral induction of UCP-2 (and UCP-4). PMID: 23800309
  20. The miR-30e/UCP2 axis plays a significant role in mediating TGF-beta1-induced epithelial-mesenchymal transition and kidney fibrosis. PMID: 23515048
  21. The expression of SIRT1 is significantly decreased, and UCP2 expression is increased in the liver of rats with T2DM and NAFLD. PMID: 22588935
  22. Hippocampal UCP2 expression increases 12 to 48 hours after status epilepticus induction. PMID: 22849356
  23. Resveratrol upregulates hepatic UCP2 expression and prevents the development of nonalcoholic fatty liver disease in a high-fat diet-treated rodent model. PMID: 23084643
  24. UCP2 is a critical protein in preventing oxidative stress damage in renal mesangial cells in vitro. PMID: 23297375
  25. Pingtang recipe containing drug-serum exhibits a protective effect on INS-1 beta pancreatic cells against lipoapoptosis by regulating ROS production and UCP-2 expression. PMID: 21179742
  26. Blockade of the diabetes-induced upregulation of UCP- 2 results in excessive uncoupling and reduced oxidative stress in the kidney via activation of ANT. PMID: 22768304
  27. Following vagotomy, ATP contents decreased, and UCP2 expression was downregulated in the stomach corpus. PMID: 21162199
  28. UCP2 mRNA expression in the hypothyroidism group was significantly lower than that of the control group. PMID: 21190599
  29. The expression of UCP2 mRNA in the liver failure group was higher compared to the control group. Expression may be related to levels of SOD, MDA, and endotoxin. PMID: 21272461
  30. Ucp2 and PPARdelta gene and protein expression increased in rats fed a fructose-rich diet. PMID: 21855553
  31. Berberine can downregulate the expression levels of UCP2 mRNA and UCP2 proteins in hepatic tissue in non-alcoholic fatty liver disease rats. PMID: 21359922
  32. UCP2 plays both regulatory and protective roles in beta cells by acutely lowering glucose-stimulated insulin secretion and chronically preventing oxidative stress. PMID: 21172424
  33. The frequency of beta cell apoptosis in high-fat feeding rats is influenced by oxidative stress, which results in increasing UCP2 gene expression. PMID: 20014488
  34. UCP2 expression is rapidly induced via the peroxisome proliferator-activated receptor pathway, thereby increasing cell apoptosis in adult rat cardiomyocytes. PMID: 20010438
  35. The expression of UCP2 was upregulated in pressure overload-induced failure hearts and may contribute to decreased myocardial adenine nucleotide and energy metabolism disturbance. PMID: 20193183
  36. PGC-1alpha is induced by cerebral ischemia, leading to upregulation of UCP2 and SOD2, thereby providing a neuroprotective effect against ischemic brain injury in the hippocampus by ameliorating oxidative stress. PMID: 19774674
  37. UCP2 expression is induced by long-term cold exposure, promoting decoupling of oxidative phosphorylation. PMID: 11710805
  38. UCP-2 mRNA is induced by fatty acid oxidation in beta-cells. PMID: 11897694
  39. Studies have investigated the impact of intracerebroventricular mouse leptin on energy metabolism and the expression of uncoupling protein 2 in brown adipose tissue following 21 days of recovery. PMID: 12062312
  40. Superoxide (or its products) exerts its uncoupling effect by activating the proton transport mechanism of UCP2 at the matrix side of the mitochondrial inner membrane. PMID: 12372827
  41. The downregulation of heartUCP2 parallels lower lipid utilization, which may contribute to enhanced fat deposition in dietary obese rats. PMID: 12435081
  42. Thiazolidinediones indirectly stimulate ucp2 transcription by inducing, via PPARgamma, limiting amounts of a protein, which must be phosphorylated by MAPK to stimulate the gene. PMID: 12588051
  43. Triiodothyronine selectively enhances transcriptional stimulation of ucp2 by thiazolidinediones and nonselective PPAR ligands by priming the gene to a transactivating signal(s) generated by such ligands. PMID: 12588052
  44. Effects of dietary protein content on uncoupling proteins (UCP) 1, 2, and 3 expression in various tissues of Zucker lean and obese rats were studied. PMID: 12603007
  45. Research suggests that induction of electrogenic ion transport rather than electrophoretic fatty acid activity induced expression of hepatic uncoupling protein 2 (UCP-2) in rats. PMID: 12756242
  46. Data refute the hypothesis that UCP-2 causes decreased cardiac mechanical efficiency in septic shock. PMID: 12785014
  47. Evidence suggests that uncoupling protein-2 is an inducible protein that exhibits neuroprotective properties by activating cellular redox signaling or by inducing mild mitochondrial uncoupling, which prevents the release of apoptogenic proteins. PMID: 12858170
  48. Downregulation of UCP-2 mRNA by IL-1beta is an early event in cytokine interaction with beta-cells, not directly linked to cell toxicity. PMID: 12967645
  49. UCP2 appears to be regulated by the excitatory stimulus via the cAMP-PKA cascade and serves to negatively control synaptic output by reducing intracellular ATP levels. PMID: 14511123
  50. Sympathetic tonus generated by exposure of rats to cold induces the expression of PGC-1, which participates in the control of UCP-2 expression in pancreatic islets. PMID: 14576981

Show More

Hide All

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a variety of organs, with predominant expression in the heart, lung and spleen.

Q&A

What is the primary function of mitochondrial UCP2 in cellular metabolism?

UCP2 functions primarily as a proton carrier across the inner mitochondrial membrane that uncouples ATP synthesis by dissipating the proton gradient. This process results in decreased ATP production and heat generation. Unlike its homolog UCP1 (which is predominantly expressed in brown adipose tissue), UCP2 is found in a wider variety of tissues and serves multiple physiological functions beyond thermogenesis. It plays significant roles in regulating reactive oxygen species (ROS) production, modulating mitochondrial calcium uptake, and influencing various metabolic pathways .

The functionality of UCP2 as an uncoupling protein remains somewhat controversial, as some research groups have failed to observe differences in proton leak between wild-type and UCP2 knockout mice when examining mitochondria from tissues with high UCP2 expression levels such as lung or spleen .

How does UCP2 expression differ across rat tissues under normal physiological conditions?

The distribution pattern of UCP2 across tissues reflects its diverse physiological roles, including potential regulatory functions in organs with high metabolic demands. This tissue-specific expression pattern is important for researchers to consider when designing experiments, as baseline expression levels will significantly impact the interpretation of results from different tissue types.

What are the key structural characteristics of recombinant rat UCP2 that researchers should be aware of?

Recombinant rat UCP2 is a mitochondrial carrier protein with structural features common to the UCP family. As an integral membrane protein of the mitochondrial inner membrane, it functions as a proton channel or shuttle . The protein shares homology with brown fat uncoupling protein UCP1, belonging to a family of genes found in both animals and plants .

For researchers working with recombinant rat UCP2, it's essential to understand that proper protein folding and membrane insertion are critical for functional studies. The protein contains multiple transmembrane domains that are important for its channel activity, and modifications to these regions can significantly alter function. When producing recombinant UCP2, maintaining the native conformation is crucial for valid experimental outcomes, particularly in functional assays examining proton conductance or ligand interactions.

What are the optimal methods for detecting UCP2 expression in rat tissue samples?

For reliable detection of UCP2 expression in rat tissue samples, researchers should employ a combination of complementary techniques:

  • RT-PCR Analysis: Semi-quantitative or quantitative RT-PCR represents an effective approach for analyzing UCP2 mRNA expression. Based on established protocols, researchers can use primers such as 5'-GGCTGGTGGTGGTCGGAGAT-3' and 5'-CCGAAGGCAGAAGTGAAGTG-3' with PCR conducted for approximately 27 cycles for UCP2 and 25 cycles for GAPDH (as housekeeping control) . The products can be analyzed through 1.2% agarose gel electrophoresis and quantified using imaging software to express results as a ratio of UCP2 to GAPDH band intensity.

  • Immunohistochemistry: This technique allows visualization of UCP2 protein expression and its intralobular distribution within tissues, providing spatial information that molecular techniques cannot. This approach is particularly valuable when examining heterogeneous tissues like liver, where UCP2 expression may vary between different cell types (e.g., hepatocytes versus Kupffer cells) .

  • Western Blotting: For quantitative protein expression analysis, western blotting using specific antibodies against rat UCP2 provides reliable data on protein levels in tissue homogenates or isolated mitochondrial fractions.

It's important to note that there may be discrepancies between mRNA and protein levels due to post-transcriptional regulation of UCP2, so researchers should ideally combine these approaches for comprehensive analysis .

How can researchers effectively design overexpression systems for studying rat UCP2 function?

When designing overexpression systems for rat UCP2 functional studies, researchers should consider the following methodological aspects:

  • Vector Selection: Choose expression vectors with promoters appropriate for the target cell type. For primary rat cardiomyocytes or hepatocytes, vectors with strong constitutive promoters like CMV or cell-specific promoters may be used depending on the experimental goals.

  • Verification of Expression: Confirm successful UCP2 overexpression through multiple methods including western blotting, immunocytochemistry, and functional assays. Studies have shown that overexpression of UCP2 in primary cardiomyocytes leads to significant changes in cellular bioenergetics, including reduced ATP levels and development of acidosis .

  • Functional Assessment: Include appropriate assays to measure the biological effects of UCP2 overexpression, such as:

    • ATP level measurements to assess bioenergetic changes

    • pH measurements to detect acidosis

    • ROS production assays to evaluate effects on oxidative stress

    • Cell viability assays under normal and stress conditions (e.g., hypoxia-reoxygenation)

  • Controls: Always include proper controls, including empty vector transfections and, when possible, UCP2 variants with mutations in key functional domains to distinguish specific effects of UCP2 activity from non-specific consequences of protein overexpression.

Studies have demonstrated that UCP2 overexpression can significantly impact cell survival during stress conditions. For example, cardiomyocytes overexpressing UCP2 showed increased sensitivity to hypoxia-reoxygenation compared to control cells, associated with upregulation of proapoptotic proteins like BNIP3 .

What experimental models are most appropriate for studying UCP2 in the context of oxidative stress?

Several experimental models have proven valuable for investigating UCP2's role in oxidative stress:

  • Ischemia-Reperfusion (I/R) Models: Partial lobar ischemia followed by reperfusion in rats effectively demonstrates UCP2 induction in response to oxidative stress. Researchers have used both short (40 minutes) and long (90 minutes) ischemia protocols followed by 4 hours of reperfusion to study differential UCP2 responses . This model allows examination of both ischemic and non-ischemic lobes within the same animal.

  • Cell Culture Models with Oxidative Stressors: Primary rat cells (hepatocytes, cardiomyocytes) exposed to:

    • Hypoxia-reoxygenation conditions

    • Hydrogen peroxide treatment

    • Mitochondrial redox cycling agents that increase mitochondrial ROS production

  • Genetic Models: UCP2 knockout and transgenic overexpression models provide valuable insights into UCP2's role in oxidative stress responses. RNAi approaches using UCP2 short interfering RNA can be employed to examine the effects of UCP2 downregulation .

For quantifying oxidative stress in these models, malondialdehyde (MDA) concentration measurement serves as a reliable marker of lipid peroxidation . Researchers should note that UCP2 expression demonstrates intralobular heterogeneity that correlates inversely with areas of necrosis, suggesting cell-specific responses to oxidative stress even within the same tissue .

What are the primary transcriptional regulators of UCP2 expression in rat tissues?

UCP2 expression is regulated by multiple transcriptional mechanisms that respond to metabolic and stress signals:

  • Inflammatory Mediators: Tumor necrosis factor-α (TNF-α) has been shown to induce UCP2 expression in hepatocytes via a TNF-α dependent mechanism. This pathway is particularly relevant in conditions like ischemia-reperfusion where TNF-α is released into circulation .

  • Oxidative Stress Signaling: Increased mitochondrial ROS production upregulates UCP2 mRNA in primary cultures of normal rat hepatocytes. This represents a potential adaptive response, as UCP2 induction may help mitigate further ROS generation .

  • Metabolic Regulators: While specific transcription factors weren't detailed in the search results, the literature suggests that metabolic signals related to fatty acid metabolism and glucose homeostasis influence UCP2 transcription in various tissues.

The transcriptional regulation shows considerable tissue specificity and context-dependence. For instance, in healthy liver, UCP2 mRNA is confined to Kupffer cells, but hepatocytes can be induced to express UCP2 under certain conditions . This suggests that cell-type specific transcriptional control mechanisms govern UCP2 expression patterns.

How is UCP2 regulated at the post-translational level, and what methodologies can detect these modifications?

UCP2 undergoes several post-translational regulatory mechanisms that influence its activity and stability:

  • Protein Turnover Regulation: UCP2 is subject to rapid turnover, with a relatively short half-life compared to many other mitochondrial proteins. This allows for dynamic regulation of UCP2 levels in response to changing cellular conditions .

  • Proton Conductance Modifications: UCP2 proton conductance can be modified through interactions with specific ligands and post-translational modifications. These modifications can alter the protein's uncoupling activity without necessarily changing expression levels .

  • Ligand Interactions: Various molecules can interact with UCP2 to modulate its activity. While the specific ligands weren't detailed in the search results, the literature suggests that fatty acids and other metabolites can influence UCP2 function.

Methodologies for detecting these modifications include:

  • Pulse-chase experiments to assess protein turnover rates

  • Mitochondrial membrane potential assays to measure changes in proton conductance

  • Co-immunoprecipitation studies to identify interacting partners

  • Mass spectrometry to identify specific post-translational modifications

Understanding these regulatory mechanisms is crucial for interpreting experimental results, as UCP2 activity may change independently of mRNA or even protein expression levels due to post-translational regulation .

What role do single nucleotide polymorphisms play in UCP2 function and how can researchers account for genetic variability?

Single nucleotide polymorphisms (SNPs) in the UCP2 gene can significantly impact its expression and function, potentially influencing experimental outcomes:

The −866G>A (rs659366) polymorphism has been extensively studied and is associated with altered UCP2 mRNA expression levels. This polymorphism has been linked to various metabolic phenotypes including:

PolymorphismBiological effectDisease associationTotal subjects studied
−866G>A (rs659366)Higher UCP2 mRNA expressionAbdominal obesity2,367
Obesity and hyperinsulinemia440
Obesity treated with sibutramine131
Diabetes and myocardial infarction901
Obesity and T2D17,636
Childhood obesity and metabolic disorders200
T2D treated with rosiglitazone354
T2D and high-sensitivity C reactive protein383
T2D and coronary artery disease464
Diabetic retinopathy188
Diabetic retinopathy697

To account for genetic variability in UCP2 research, investigators should:

  • Genotype Experimental Animals: When using outbred rat strains, researchers should consider genotyping for known UCP2 polymorphisms that might influence experimental outcomes.

  • Use Inbred Strains: Utilizing inbred rat strains with known UCP2 genotypes can reduce variability in experimental results.

  • Report Genetic Background: Clearly document the genetic background of experimental animals in publications to facilitate comparison across studies.

  • Consider Polymorphisms in Human Studies: In translational research, acknowledge the potential impact of human UCP2 polymorphisms when extrapolating findings from rat models .

How does UCP2 expression change during cardiac pathologies, and what are the implications for mitochondrial function?

UCP2 expression undergoes significant changes during cardiac pathologies, with important implications for mitochondrial function and cell survival:

In the Dahl salt-sensitive rat heart-failure model, UCP2 mRNA levels were significantly upregulated along with increased expression of the proapoptotic protein BNIP3. This suggests a potential maladaptive role of UCP2 in the progression of heart failure . The upregulation appears to be part of the cardiac response to stress, but may ultimately contribute to cellular dysfunction rather than protection.

When UCP2 is experimentally overexpressed in primary cardiomyocytes, several functional consequences are observed:

  • Significant decline in ATP levels

  • Development of cellular acidosis

  • Increased vulnerability to hypoxia-reoxygenation injury

  • Upregulation of proapoptotic proteins, particularly BNIP3

These findings suggest that elevated UCP2 expression in cardiac tissue may compromise energy production and cellular resilience during stress. Importantly, UCP2 knockdown using short interfering RNA prevented both the increase in cell death and BNIP3 expression during hypoxia-reoxygenation, indicating a causal relationship between UCP2 activity and cardiomyocyte vulnerability .

The mechanisms linking UCP2 to cardiac dysfunction likely involve energy depletion due to uncoupling of oxidative phosphorylation, which is particularly detrimental in the heart - an organ with continuously high energy demands .

What is the relationship between UCP2 expression and ischemia-reperfusion injury in the liver, and how does this compare to other tissues?

The relationship between UCP2 expression and ischemia-reperfusion (I/R) injury in the liver reveals a complex and potentially tissue-specific role for this protein:

In liver I/R models, UCP2 protein expression is induced in hepatocytes that normally do not express the protein prior to injury . This induction appears to be more pronounced in the short ischemia group (40 minutes) compared to the long ischemia group (90 minutes), despite the fact that oxidative stress (measured by malondialdehyde concentrations) was higher in the long ischemia group .

Key observations regarding hepatic UCP2 in I/R include:

  • Intralobular Distribution: UCP2 expression demonstrates intralobular heterogeneity that correlates inversely with areas of necrosis, suggesting a potential cytoprotective role .

  • Expression in Non-ischemic Lobes: Interestingly, UCP2 expression is also induced in non-ischemic lobes of the liver, albeit to a lesser extent, indicating that soluble mediators released during I/R can trigger UCP2 expression even in tissues not directly subjected to ischemia .

  • Induction Mechanisms: Two potential mechanisms have been proposed for UCP2 induction in hepatocytes after I/R:

    • TNF-α dependent pathway activated by inflammatory mediators released during I/R

    • Direct response to increased mitochondrial ROS production

Compared to cardiac tissue, where UCP2 overexpression appears predominantly detrimental , the liver demonstrates a more nuanced response. While the primitive role of UCP2 expression in the liver may be cytoprotective (attempting to limit ROS production), its actual protective effect in hepatic I/R appears to be minimal . This suggests tissue-specific differences in how UCP2 induction impacts cellular outcomes during similar stress conditions.

What evidence supports the role of UCP2 in regulating reactive oxygen species, and how can this be experimentally verified?

Multiple lines of evidence support UCP2's role in regulating reactive oxygen species (ROS), though with some experimental complexities:

  • Mechanistic Basis: UCP2 is proposed to decrease ROS production by lowering the mitochondrial membrane potential through proton leakage across the inner mitochondrial membrane. This "mild uncoupling" reduces electron leakage from the respiratory chain, which is a major source of mitochondrial ROS .

  • Genetic Evidence: Studies with UCP2 knockout mice have demonstrated enhanced ability to destroy intracellular pathogens due to alterations in ROS formation, suggesting that UCP2 normally constrains ROS production .

  • Expression Patterns: UCP2 is upregulated in response to increased oxidative stress in various tissues, suggesting an adaptive response aimed at limiting further ROS accumulation .

To experimentally verify UCP2's role in ROS regulation, researchers can employ several approaches:

  • Genetic Manipulation:

    • Compare ROS production in UCP2 knockout vs. wild-type tissues under basal and stressed conditions

    • Use UCP2 siRNA to acutely downregulate expression and measure resulting changes in ROS

    • Create UCP2 overexpression models and examine effects on ROS levels

  • Pharmacological Approaches:

    • Apply known UCP2 activators or inhibitors and measure changes in ROS production

    • Use mitochondria-targeted antioxidants alongside UCP2 manipulation to assess the specific contribution of UCP2 to ROS management

  • ROS Measurement Techniques:

    • Direct measurement of ROS using fluorescent probes (e.g., DCF, MitoSOX)

    • Assessment of oxidative damage markers (e.g., malondialdehyde for lipid peroxidation, protein carbonylation, 8-OHdG for DNA damage)

    • Measurement of antioxidant enzyme activities and glutathione levels to assess compensatory responses

  • Mitochondrial Function Assays:

    • Membrane potential measurements to assess the degree of uncoupling

    • Oxygen consumption rates under different respiratory states

    • ATP production capacity and ATP/ADP ratios

These experimental approaches can help resolve some of the contradictions in the literature regarding UCP2's role in ROS regulation across different tissues and experimental conditions.

How can researchers reconcile contradictory findings regarding UCP2's protective versus detrimental effects in cellular stress responses?

The literature contains significant contradictions regarding UCP2's role in cellular stress responses, with evidence supporting both protective and detrimental effects. To reconcile these findings, researchers should consider several key factors:

  • Tissue-Specific Contexts: UCP2's effects appear to be highly tissue-specific. In cardiomyocytes, UCP2 overexpression increases vulnerability to hypoxia-reoxygenation , while in other tissues, it may exert protective effects by limiting ROS production . Researchers should avoid generalizing findings from one tissue to another without experimental verification.

  • Expression Level Considerations: The magnitude of UCP2 expression may determine whether its effects are beneficial or harmful. Mild uncoupling may reduce ROS without significantly compromising ATP production, while excessive uncoupling may deplete ATP to detrimental levels. Studies should carefully quantify the degree of UCP2 expression/activity relative to physiological ranges.

  • Temporal Dynamics: The timing of UCP2 induction relative to the stress stimulus may determine outcomes. Pre-conditioning with moderate UCP2 activation might be protective, while acute upregulation during stress might exacerbate energy deficits. Time-course experiments are essential for understanding these dynamics.

  • Methodological Standardization: Different studies use varied experimental approaches, from acute genetic manipulation to chronic knockout models, potentially explaining discrepant results. Standardized protocols for measuring UCP2 activity and relevant outcomes would facilitate comparison across studies.

As highlighted in the literature, "some studies show a protective role of UCP2, whereas others demonstrate the opposite effect" . This emphasizes the need for contextual interpretation rather than seeking a universal characterization of UCP2 as either "protective" or "detrimental."

What are the current controversies regarding UCP2's primary physiological function, and what experimental approaches might resolve them?

Major controversies regarding UCP2's primary physiological function persist in the scientific literature:

  • Uncoupling Activity Controversy: Despite being classified as an uncoupling protein, "its status as a functional UCP is much in doubt by several research groups" . Some researchers have failed to observe differences in proton leak between wild-type and UCP2 knockout mice in tissues with high UCP2 expression levels (lung, spleen) . This fundamental question about UCP2's basic function remains unresolved.

  • Metabolic Role Debate: There is "no consistent correlation between UCP2 (or UCP3) expression and increase in energy expenditure" , challenging the proposed role of UCP2 in regulating whole-body metabolism similar to UCP1's thermogenic function.

  • Primary Function Question: Multiple functions have been assigned to UCP2, including:

    • Mediating proton leak

    • Negatively regulating ROS production

    • Regulating insulin metabolism

    • Modulating mitochondrial calcium uptake

    • Influencing apoptotic processes

To resolve these controversies, several experimental approaches could be valuable:

  • Improved Proton Conductance Measurements:

    • Development of more sensitive techniques to measure subtle changes in proton conductance

    • Use of reconstituted systems with purified UCP2 protein to directly assess transport properties

    • Application of new technologies like patch-clamp of mitochondrial membranes

  • Structure-Function Analysis:

    • Creation of UCP2 mutants with targeted modifications to dissect domains responsible for different functions

    • Comparison with other UCP family members to identify conserved versus unique functions

  • Physiological Context Studies:

    • Examination of UCP2 function under varied metabolic conditions rather than standard laboratory settings

    • Investigation of species-specific variations that might explain contradictory findings

  • Systems Biology Approaches:

    • Integration of metabolomics, proteomics, and transcriptomics to understand UCP2's place in broader cellular networks

    • Computational modeling of mitochondrial bioenergetics with and without UCP2 activity

How do different experimental models affect observed outcomes in UCP2 research, and what standardization approaches might improve consistency?

Experimental model selection significantly impacts observed outcomes in UCP2 research, contributing to inconsistent findings across studies:

  • In Vitro vs. In Vivo Discrepancies: The literature contains "numerous contradictory in vitro and in vivo studies... with quite divergent results from different laboratories" . Cell culture models may not fully recapitulate the complex regulatory environment present in intact organisms.

  • Species-Specific Variations: There are "species-specific variations" in UCP2 distribution and function . Results from mouse models may not directly translate to rats or humans, complicating cross-species comparisons.

  • Acute vs. Chronic Manipulation: Acute overexpression or knockdown of UCP2 may produce different outcomes compared to genetic knockout models due to compensatory mechanisms that develop in the latter.

  • Cell Type Considerations: Even within a single organ, different cell types may express UCP2 differently. In liver, UCP2 is expressed in Kupffer cells but not healthy hepatocytes under normal conditions , highlighting the importance of cell-type specific analyses.

To improve consistency and facilitate comparison across studies, several standardization approaches could be implemented:

  • Model Reporting Standards:

    • Detailed documentation of experimental models including species, strain, age, sex

    • Specification of cell types examined and isolation/culture methods

    • Clear reporting of UCP2 manipulation approach (overexpression, knockout, siRNA)

  • Multi-Model Validation:

    • Testing hypotheses across multiple experimental systems (cell lines, primary cells, animal models)

    • Confirming key findings using both gain- and loss-of-function approaches

  • Quantitative Assessment Standards:

    • Standardized methods for measuring UCP2 expression levels (mRNA and protein)

    • Consistent approaches for assessing mitochondrial function (membrane potential, respiration)

    • Validated protocols for measuring ROS and oxidative stress markers

  • Contextual Considerations:

    • Explicit characterization of metabolic state during experiments

    • Assessment of UCP2 function under both basal and stressed conditions

    • Consideration of temporal aspects of UCP2 expression and activity

Implementing these standardization approaches would facilitate more meaningful comparison across studies and potentially resolve some of the current contradictions in the literature.

How does hepatic UCP2 expression differ from cardiac UCP2 expression in terms of regulation and function?

Hepatic and cardiac UCP2 expression patterns show distinct differences in both baseline regulation and functional outcomes:

Hepatic UCP2 Expression and Regulation:

  • Cell-Type Specificity: In healthy liver, UCP2 mRNA is found predominantly in Kupffer cells (liver macrophages) but not in hepatocytes under normal conditions .

  • Inducibility: Hepatocytes can be induced to express UCP2 under specific conditions including:

    • Bacterial lipopolysaccharide exposure via a TNF-α dependent mechanism

    • Ischemia-reperfusion injury

    • Exposure to agents that increase mitochondrial ROS production

  • Spatial Heterogeneity: After induction, UCP2 expression shows intralobular heterogeneity that correlates inversely with areas of necrosis, suggesting localized regulation based on cellular stress levels .

Cardiac UCP2 Expression and Regulation:

  • Response to Pathology: In the Dahl salt-sensitive rat heart-failure model, UCP2 mRNA levels become significantly upregulated along with increased expression of proapoptotic proteins like BNIP3 .

  • Energy Dependence: The heart's high energy demands make it particularly sensitive to changes in ATP production, so UCP2 expression may be more tightly regulated in cardiac tissue compared to other organs .

  • Functional Impact: Overexpression of UCP2 in cardiomyocytes leads to ATP depletion, acidosis, and increased vulnerability to stress conditions like hypoxia-reoxygenation .

These tissue-specific differences likely reflect the distinct metabolic profiles and physiological roles of the liver versus the heart. The liver's remarkable regenerative capacity and metabolic flexibility may allow for more dynamic regulation of UCP2, while the heart's constant energy demands may make it more vulnerable to UCP2-mediated uncoupling effects. These differences highlight the importance of tissue-specific experimental approaches when studying UCP2 function.

What methodological approaches are most effective for studying UCP2 in primary rat neuronal cells compared to other cell types?

While the search results don't specifically address neuronal UCP2, we can extrapolate appropriate methodological approaches based on techniques successfully employed in other cell types:

Considerations for Neuronal UCP2 Research:

  • Isolation and Culture Techniques:

    • Primary neuronal cultures require specialized isolation protocols to maintain neuronal viability and function

    • Consider using region-specific isolation (e.g., cortical, hippocampal, or cerebellar neurons) to account for potential regional differences in UCP2 expression

    • Co-culture systems with glial cells may better reflect in vivo conditions while adding complexity to interpretation

  • UCP2 Detection Methods:

    • RT-PCR protocols similar to those used for liver tissue (e.g., primers 5'-GGCTGGTGGTGGTCGGAGAT-3' and 5'-CCGAAGGCAGAAGTGAAGTG-3') can be adapted for neuronal samples

    • Immunohistochemistry with neuron-specific markers (e.g., NeuN, MAP2) for co-localization studies to distinguish neuronal from glial UCP2 expression

    • Western blotting of purified mitochondrial fractions may improve sensitivity for detecting UCP2 protein

  • Functional Assessments:

    • Neuronal-specific considerations include measuring:

      • Synaptic transmission parameters alongside bioenergetic assessments

      • Calcium dynamics, given UCP2's potential role in modulating mitochondrial calcium uptake

      • Neurite outgrowth and maintenance as indicators of neuronal health

    • Adaptation of methods used in cardiomyocytes to measure ATP levels, acidosis, and response to stressors like oxygen-glucose deprivation (neuronal equivalent of ischemia)

  • Genetic Manipulation Approaches:

    • Viral vectors (particularly lentivirus or AAV) may offer advantages over traditional transfection methods for primary neurons

    • Timing of manipulation is critical; consider both developmental and acute effects of UCP2 modulation

Compared to hepatocytes or cardiomyocytes, neurons present unique challenges including post-mitotic status, complex morphology, and high energy demands. Methods must be optimized for these cellular characteristics while maintaining the rigor demonstrated in studies of other cell types.

How can researchers effectively examine the relationship between UCP2 polymorphisms and phenotypes in translational studies from rat models to human disease?

Translating findings from rat UCP2 studies to human disease relevance requires careful methodological considerations, particularly when examining polymorphism-phenotype relationships:

  • Comparative Genomics Approach:

    • Identify conserved versus divergent regions in rat and human UCP2 genes

    • Focus on polymorphisms in highly conserved regions, which are more likely to have similar functional effects across species

    • Document the degree of sequence homology between rat and human UCP2, particularly in regulatory regions and functional domains

  • Functional Validation Strategy:

    • Test effects of relevant human UCP2 polymorphisms (e.g., -866G>A) in rat cell models

    • Create transgenic rat models expressing human UCP2 variants to study phenotypic effects

    • Compare findings from rat models with human genetic association studies for consistent patterns

  • Polymorphism Selection Guidance:

    • Prioritize well-characterized polymorphisms with established clinical associations

    • The -866G>A (rs659366) polymorphism has been extensively studied in relation to metabolic disorders and should be a primary focus

    • Consider the following human disease associations when designing translational studies:

Disease AssociationNumber of SubjectsPotential Rat Model Equivalent
Obesity and T2D17,636Diet-induced obesity models
Diabetes and myocardial infarction901Streptozotocin diabetes + coronary ligation
Obesity treated with sibutramine131Drug intervention in obese rats
T2D and coronary artery disease464Combined metabolic/cardiovascular models
Diabetic retinopathy885 (combined)Long-term diabetic rat models
  • Methodological Considerations:

    • Include sufficient sample sizes based on power calculations from human studies

    • Account for strain-specific effects in rat models that might influence UCP2 function

    • Control for environmental factors (diet, activity) that might modulate UCP2 expression

    • Consider tissue-specific effects, as polymorphism impacts may vary across tissues

  • Integrated Biomarker Approach:

    • Measure consistent biomarkers across rat and human studies

    • Include assessments of oxidative stress markers, given UCP2's role in ROS regulation

    • Consider metabolomic profiling to identify conserved metabolic signatures associated with UCP2 variants

By employing these methodological approaches, researchers can enhance the translational value of rat UCP2 studies and improve the predictive validity for human disease applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.