Recombinant Rat Mitochondrial uncoupling protein 3 (Ucp3)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Substrate Specificity

Recombinant UCP3 functions as a strict exchanger of metabolites rather than a proton uncoupler. Substrate specificity studies reveal:

SubstrateTransport EfficiencySpecies TestedReference
AspartateHighHuman, Murine
MalateHighHuman, Murine
PhosphateModerateHuman, Murine
SulfateModerateMurine
OxaloacetateLowHuman
  • Key finding: UCP3 cannot perform unidirectional transport, distinguishing it from UCP2 .

  • Inhibitors: Tannic acid, pyridoxal-5’-phosphate, and butylmalonate strongly inhibit aspartate/malate exchange .

Transport Kinetics

Kinetic parameters differ between UCP3 and UCP2, reflecting distinct physiological roles:

ParameterUCP3 (Human)UCP2 (Human)
KmK_m (aspartate)0.12 mM0.83 mM
VmaxV_{max} (aspartate)350 µmol/min/mg70 µmol/min/mg
Substrate preferenceAspartate > malate > phosphatePhosphate > aspartate

Data from

Murine UCP3 exhibits a VmaxV_{max} of 23.9 ± 5.8 µmol/min/mg for aspartate/phosphate exchange , consistent with human findings.

Functional Controversies

Despite early hypotheses linking UCP3 to thermogenesis, recombinant studies show:

  • No proton uncoupling: UCP3 does not increase mitochondrial proton leak unless overexpressed artifactually .

  • Role in lipid metabolism: UCP3 facilitates fatty acid oxidation and mitigates oxidative stress by exporting lipid peroxides .

  • Exercise/fasting response: UCP3 upregulation during these states aligns with increased aspartate/malate shuttling for gluconeogenesis .

Research Gaps and Future Directions

  1. Species-specific data: Rat Ucp3 requires direct kinetic and structural validation.

  2. In vivo relevance: Most studies use in vitro reconstituted systems; genetic knockout models could clarify physiological roles .

  3. Therapeutic potential: UCP3’s role in cardiac and metabolic diseases warrants exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a preferred tag type, please specify it and we will prioritize its development.
Synonyms
Ucp3; Slc25a9; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ucp3
Target Protein Sequence
MVGLQPSEVPPTTVVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGVQSVQYRGVLG TILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGTDHSSVAIRILAG CTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWP NITRNAIVNCAEMVTYDIIKEKLLDSHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTR YMNAPPGRYRSPLHCMLRMVAQEGPTAFYKGFMPSFLRLGSWNVMMFVTYEQLKRALMKV QVLRESPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thereby uncoupling oxidative phosphorylation. As a result, energy is dissipated as heat. UCPs may play a role in regulating tissue respiratory control. They participate in thermogenesis and energy balance.
Gene References Into Functions

References related to UCP3 Function:

  1. Data suggest that UCP3 expression, energy metabolism, and uptake/beta-oxidation of free fatty acids in skeletal muscle can be regulated by dietary components; here, ursolic acid, a dietary triterpenoid, has anti-obesity effects. PMID: 25944715
  2. Based on Ucp3 content, a decrease in oxidative capacity and proton leak in intermyofibrillar and subsarcolemmal mitochondria could induce a decline in energy expenditure and thus contribute to the reduced resting metabolic rate found in old rats. PMID: 24950599
  3. Endurance training blocked the high-sugar diet induced up-regulation of UCP1 expression in interscapular brown adipose tissue, whereas it up-regulated the expression of Ucp3 mRNA in muscle. PMID: 23084644
  4. Examined the effect of D-Asp uptake on the expression of the mitochondrial uncoupling protein-3 (UCP3), beta-actin, and alpha-tubulin in rat Harderian gland. PMID: 21524945
  5. High fat diets increase the expression of fatty acid oxidation enzymes such as UCP3,PDK4, and MCAD concomitant with elevated plasma fatty acid levels and the induction of PGC-1 beta, but independent of changes in AMPK, p38, and PKA signaling. PMID: 21084676
  6. These findings indicate that changes in Intramyocellular lipids content but not UCP3 content are implicated in short-term effects of cafeteria-style diet and exercise training on muscular insulin sensitivity in rats. PMID: 20428795
  7. In the mouse C2C12 myoblast cell line, UCP3 has a short half-life of 0.5-4 h. Its turnover is proteasome dependent. PMID: 19954423
  8. Superoxide activates mitochondrial uncoupling proteins PMID: 11780125
  9. After 1 week cold exposure the protein level of UCP3 decreased, contrary to its own mRNA level in rat brown adipose tissue. PMID: 12023047
  10. SREBP-1c mimics the effect of insulin on UCP3 gene expression PMID: 12031958
  11. increased availability of NEFA resulted in an increase in gene expression in both skeletal and heart muscle PMID: 12037655
  12. energy metabolism and expression of uncoupling protein 3 in brown adipose tissue after 21 days of recovery from intracerebroventricular mouse leptin in rats PMID: 12062312
  13. Close association between fasting-induced changes in UCP2 and UCP3 gene expression with those of key regulators of lipid oxidation and hence consistent with hypothesis that these UCP homologs may be involved in lipid metabolism. PMID: 12397391
  14. Both mitochondrial populations in skeletal muscle cells from rats with increased thermogenesis display an increased fatty acid-induced uncoupling and UCP3 content, which could contribute to avoiding obesity. PMID: 12466947
  15. Effects of dietary protein content on uncoupling proteins (UCP) 1, 2 and 3 expression in various tissues of Zucker lean and obese rats were studied; A possible thermogenic function of UCP3 in muscle and white adipose tissue of obese rats was noted PMID: 12603007
  16. Upregulation of mitochondrial uncoupling protein 3 in the developing rat heart correlates with changes in mitochondrial membrane potential. PMID: 12676547
  17. The role of Ucp3 in lipid metabolism in fasting rats treated with triiodothyronine. PMID: 12692085
  18. sepsis upregulates the gene and protein expression of UCP3 in skeletal muscle, which may at least in part be mediated by glucocorticoidss and free fatty acids. PMID: 12721157
  19. The correlation of abdominal muscle UCP3 expression with overweight in males could be related to their relative resistance to gain weight after chronic overeating, by the purported role of UCP3 in the regulation of lipid utilization. PMID: 12750152
  20. UCP3 is a mediator of adaptive thermogenesis pertaining to weight regulation PMID: 12782304
  21. After activation of AMPK, UCP-3 expression in fast twitch tibialis anterior muscle at mRNA level was elevated and corresponded to increase in UCP-3 protein. PMID: 12813156
  22. UCP3 has a role in rat heart in metabolic gene switching but not in mitochondrial respiratory coupling PMID: 14733944
  23. T(3) treatment increased the mRNA levels of both uncoupling protein 2 (UCP2) and UCP3, but the protein level only of UCP3 in harderian gland PMID: 15064282
  24. UCP3 is present in mitochondria isolated from thymus and from reticulocytes, monocytes and lymphocytes of spleen. UCP 3 abundance is augmented in mitochondria isolated from thymus and mitochondria isolated from lymphocytes of the spleen from fasted rats PMID: 15262223
  25. During exposure to chronic low-frequency stimulation, muacle mitochondria were generated with a lower complement of UCP-3. PMID: 15308491
  26. UCP3 mRNA of the plantaris muscles during the period post exercise was significantly greater than that from control. PMID: 15346231
  27. In healthy rats, a single dose of thiazolidinedionesrapidly increases UCP-3 mRNA in skeletal muscle and plasma. PMID: 15349725
  28. Mitochondrial UCPs (UCP2, UCP3, UCP4) may play both a protective role against oxidative damage and a thermal signaling role in the eighth nerve. PMID: 15464300
  29. UCP3 activity is stimulated by triiodothyronine in vivo by affecting the complex network of biochemical pathways underlying the UCP3 activation. PMID: 15757654
  30. Muscle UCP3 protein content increased with long-term caloric restriction, consistent with a role in protection from ROS but inconsistent with the observed decrease or no change in proton leak PMID: 15886224
  31. Ucp2 and Ucp3 function in concert to augment tolerance to cardiac ischemia. PMID: 16079144
  32. UCP3 attenuates endogenous radical production by the mitochondrial electron transport chain at high protonmotive force. PMID: 16084485
  33. could play an important role modulating the dopaminergic and noradrenergic neurotransmission within discrete brain regions. PMID: 16387447
  34. Results are consistent with a role for UCP3 in preventing accumulation of triglyceride in both adipose tissue and muscle. PMID: 16434555
  35. Fenofibrate programs a gene-expression pattern able to modulate lipid handling and UCP3 activation. PMID: 16595124
  36. T(3)-induced early UCP3 expression depended on fatty acid-PPAR signaling because depleting serum fatty acid levels abolished its expression PMID: 17478558
  37. Induction of Ucp3 suppresses mitochondrial oxidant emission during fatty acid-supported respiration. PMID: 17761668
  38. Benidipine up-regulates not only UCP1 gene expression in BAT but also UCP3 gene expression in BAT and gastrocnemius muscle, which may contribute to thermogenesis in rats. PMID: 17878603
  39. SIRT1 acts as a major repressor of ucp3 gene expression in response to glucocorticoids. PMID: 17884810
  40. data demonstrate that the exercise-induced adaptations of UCP3 protein levels are muscle specific in obese animals compared with lean animals. PMID: 18685530
  41. UCP-2 is the only isoform detectable in the kidney and UCP-2 protein can be detected in proximal tubular cells and cells of the medullary thick ascending loop of Henle PMID: 19227473
  42. It is concluded that UCP2 and UCP3 are implicated in the age-depended heart dysfunction and development of the pathological mechanisms during ischemia-reperfusion. PMID: 19526854
Database Links

KEGG: rno:25708

STRING: 10116.ENSRNOP00000024005

UniGene: Rn.9902

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of mitochondrial UCP3?

Contrary to its initial characterization solely as a proton transporter that decreases respiratory efficiency, current evidence demonstrates that recombinant human UCP3 functions primarily as a metabolite transporter. When reconstituted into liposomes, UCP3 efficiently catalyzes the strict exchange of several metabolites, including aspartate, malate, oxaloacetate, and phosphate. Unlike its homolog UCP2, UCP3 cannot catalyze unidirectional substrate transport, suggesting a more specialized metabolic role beyond simple uncoupling . This transport function may explain why UCP3 expression increases during fasting and exercise—conditions that would seemingly contradict an energy-wasting uncoupling function .

How does UCP3 differ from other uncoupling proteins, particularly UCP2?

Despite significant sequence homology, UCP3 exhibits distinct functional characteristics compared to UCP2:

CharacteristicUCP3UCP2
Transport modeStrict exchange onlyBoth exchange and unidirectional transport
Affinity for aspartate (Km)0.92 ± 0.08 mM~6.92 ± 0.85 mM (approximately 7× lower affinity)
Substrate specificityHighest for aspartate and malateSimilar but with different affinities
Tissue distributionPredominantly skeletal muscleMore widespread

These biochemical differences suggest that despite partial overlaps in substrate specificity, UCP3 and UCP2 likely serve distinct physiological roles specific to different tissues .

What is known about the tissue distribution of UCP3 in rats?

In rats, UCP3 is predominantly expressed in skeletal muscle, particularly in fast-twitch muscle fibers, with lower expression levels in the heart and brown adipose tissue. Unlike UCP1, which is largely restricted to brown adipose tissue, UCP3's tissue-specific expression pattern suggests specialized metabolic functions rather than a primary role in thermoregulation. The specific distribution pattern becomes especially relevant when designing tissue-specific knockout models or when interpreting physiological studies across different muscle types .

What are the recommended methods for expressing and purifying recombinant rat UCP3?

For efficient expression and purification of recombinant rat UCP3:

  • Expression system selection: The preferred system is E. coli C0214(DE3) strain, which yields high levels of protein in inclusion bodies.

  • Vector construction: The UCP3 coding sequence should be amplified from rat skeletal muscle cDNA using PCR with primers containing appropriate restriction sites (e.g., NdeI and HindIII) for cloning into an expression vector such as pRUN.

  • Protein purification protocol:

    • Harvest inclusion bodies by centrifugation

    • Purify on a sucrose density gradient

    • Wash with PE buffer (10 mM PIPES, 1 mM EDTA, pH 6.9)

    • Perform multiple washes with buffer containing 3% Triton X-114

    • Solubilize in 1.75% sarkosyl

    • Dilute with buffer containing 3% Triton X-114

  • Reconstitution into liposomes:

    • Mix solubilized protein with preformed liposomes (L-α-phosphatidylcholine)

    • Add cardiolipin (1 mg/mL)

    • Remove detergent using Bio-Beads SM-2 Resin

    • Separate proteoliposomes from external substrate using a Sephadex G-75 column

This methodology yields functional protein suitable for transport studies and has been validated through activity assays comparing wild-type protein with inactive mutants (e.g., R282Q) .

How can researchers effectively measure UCP3 transport activity in vitro?

To accurately assess UCP3 transport activity:

  • Reconstitution system: Reconstitute purified UCP3 into proteoliposomes containing specific substrates (10 mM internal concentration).

  • Transport assays:

    • Homo-exchange experiments: Use the same substrate inside and outside proteoliposomes (e.g., [14C]aspartate/aspartate exchange)

    • Hetero-exchange experiments: Use different substrates inside and outside (e.g., [14C]aspartate uptake with various internal substrates)

  • Kinetic analysis: Determine transport affinities (Km) and specific activities (Vmax) by measuring initial transport rates at various external labeled substrate concentrations while maintaining constant internal substrate concentrations.

  • Controls and validation:

    • Include the R282Q mutant as a negative control (transport-inactive)

    • Use known inhibitors such as pyridoxal-5'-phosphate and bathophenanthroline to confirm specificity

    • Compare with parallel UCP2 reconstitutions to highlight functional differences

For UCP3, particular attention should be paid to exchange dynamics rather than unidirectional transport, as UCP3 specifically catalyzes strict exchange reactions, unlike UCP2 which can perform both transport modes .

What genetic models are available for studying UCP3 function in vivo?

Several genetic models have been developed to study UCP3 function:

  • Complete knockout models: UCP3-/- mice completely lacking UCP3 expression have been generated and characterized. These models show:

    • Normal body weight and no obesity

    • Reduced proton leak in isolated mitochondria

    • Impaired sympathomimetic-mediated thermogenesis

    • Absent lipopolysaccharide-induced thermogenesis

    • Reduced capability to oxidize fatty acids compared to wild-type counterparts

  • Heterozygous models: UCP3+/- rats with approximately 50% reduction in UCP3 expression demonstrate:

    • Normal baseline cardiac function

    • Exacerbated left ventricular diastolic dysfunction during hypertension

    • Greater increase in myocyte width under hypertensive conditions (+24% for UCP3+/- versus +10% for UCP3+/+)

  • Tissue-specific overexpression models: These allow examination of UCP3 gain-of-function in specific tissues.

These complementary models enable researchers to investigate both loss-of-function and gain-of-function phenotypes across various physiological contexts .

How does UCP3 insufficiency affect cardiac function during hypertension?

UCP3 insufficiency significantly impacts cardiac function during hypertension, as demonstrated in UCP3+/- rats subjected to high-salt diet and angiotensin II infusion (HS/Ang II):

  • Structural changes:

    • Greater thickening of left ventricular anterior and posterior walls

    • More pronounced increase in myocyte width (+24% for UCP3+/- versus +10% for UCP3+/+)

    • Trend toward greater reduction in left ventricular internal diameter

  • Functional impairment:

    • Progressive deterioration of diastolic function parameters (E/e', isovolumic relaxation time)

    • Greater increase in Tau (time constant of isovolumic relaxation)

    • More elevated myocardial performance index at the completion of the experimental protocol

This evidence identifies UCP3 insufficiency as a potential causal factor for increased incidence of left ventricular diastolic dysfunction during hypertension, suggesting UCP3's important role in maintaining cardiac function under stress conditions .

What is the relationship between UCP3 expression and cancer metabolism?

UCP3 expression shows significant associations with cancer metabolism, particularly in non-small cell lung cancer (NSCLC):

  • Expression patterns:

    • UCP3 is overexpressed in 27.6% of NSCLC cases

    • More frequently overexpressed in large cell carcinomas

    • Inversely related to necrosis in tumor tissue

  • Metabolic correlations: Linear regression analysis reveals UCP3 expression is directly linked with:

    • Glucose transporter (GLUT2)

    • Monocarboxylate transporter (MCT2)

    • Glycolysis markers (PFK1 and aldolase)

    • Phosphorylation of pyruvate dehydrogenase (pPDH)

These associations suggest UCP3 may play a role in modulating cancer cell metabolism, potentially influencing the Warburg effect and metabolic adaptations that support tumor growth. The relationship with survival outcomes indicates UCP3 could serve as a prognostic factor in certain cancers .

How does UCP3 function change during metabolic stress conditions like fasting and exercise?

Despite initial expectations that UCP3 might decrease energy efficiency, UCP3 expression actually increases during fasting and exercise—conditions when energy conservation would seem beneficial. This apparent paradox can be explained by UCP3's metabolite transport function:

  • During fasting:

    • UCP3 upregulation does not increase mitochondrial uncoupling

    • Enhanced aspartate/malate exchange may support metabolic adaptations to fasting

    • May facilitate fatty acid oxidation through metabolite shuttling

  • During exercise:

    • UCP3 likely supports the increased metabolic flux

    • Exchange of key TCA cycle intermediates (aspartate, malate, oxaloacetate) may maintain metabolic flexibility

    • Potential role in preventing oxidative damage during increased respiratory activity

This context-dependent regulation suggests UCP3 serves specialized metabolic functions beyond simple uncoupling, supporting substrate utilization and metabolic adaptation during states of increased energy demand or altered substrate availability .

What is the molecular mechanism for substrate specificity in UCP3?

The molecular determinants of UCP3's substrate specificity remain incompletely understood, but several key observations provide insight:

  • Transport kinetics: UCP3 demonstrates highest affinity for aspartate (Km = 0.92 ± 0.08 mM) and malate (Km = 1.58 ± 0.16 mM), suggesting specific binding pockets for these dicarboxylates.

  • Critical residues: The R282Q mutation in the sixth α-helix completely abolishes transport activity, indicating this conserved arginine is essential for substrate recognition or translocation .

  • Inhibitor profile: UCP3 is strongly inhibited by:

    • Butylmalonate and phenylsuccinate (dicarboxylate carrier inhibitors)

    • 1,2,3-benzentricarboxylate (citrate carrier inhibitor)

    • Bongkrekate but not carboxyatractyloside (differential sensitivity to adenine nucleotide carrier inhibitors)

This inhibition pattern suggests structural similarities with other mitochondrial carriers but with unique features determining its substrate selectivity. Detailed structural studies, particularly crystal structures of UCP3 with bound substrates, would significantly advance understanding of these mechanisms .

How do post-translational modifications regulate UCP3 activity?

While the search results don't directly address post-translational modifications (PTMs) of UCP3, this represents an important frontier in UCP3 research. Based on studies of related proteins:

  • Potential regulatory PTMs:

    • Phosphorylation may alter substrate affinity or transport kinetics

    • Glutathionylation could respond to oxidative stress conditions

    • Acetylation might integrate UCP3 function with metabolic status

  • Research approaches:

    • Mass spectrometry analysis of UCP3 under various physiological conditions

    • Site-directed mutagenesis of potential modification sites

    • Correlation of PTM patterns with transport activity

  • Physiological contexts: Investigation of how stress conditions (oxidative stress, metabolic challenges) might trigger PTMs that alter UCP3 function represents an important research direction .

How does the transport mechanism of UCP3 differ from conventional mitochondrial carriers?

UCP3 exhibits several distinctive features compared to conventional mitochondrial carriers:

  • Strict exchange requirement: Unlike many carriers that can catalyze unidirectional transport, UCP3 demonstrates a strict requirement for exchange, suggesting a conformational mechanism that requires counter-substrate binding to complete the transport cycle .

  • Substrate profile: UCP3 efficiently transports aspartate, malate, and oxaloacetate, but not adenine nucleotides, distinguishing it from the adenine nucleotide translocase .

  • Inhibitor sensitivity: UCP3 shows differential sensitivity to classic mitochondrial carrier inhibitors, being inhibited by bongkrekate but not carboxyatractyloside .

These mechanistic differences suggest UCP3 has evolved specific transport characteristics that support its physiological role. Comparative studies of transport mechanisms between UCP3 and other carriers would provide valuable insights into the evolution and specialization of mitochondrial transport proteins .

What emerging techniques could advance UCP3 research?

Several cutting-edge approaches have potential to significantly advance UCP3 research:

  • Cryo-electron microscopy: Determining the high-resolution structure of UCP3 would provide critical insights into its transport mechanism and substrate specificity.

  • Mitochondrial metabolomics: Comprehensive analysis of metabolite changes in UCP3-deficient or overexpressing models could reveal the full spectrum of physiological substrates.

  • In situ transport assays: Development of methods to measure UCP3-mediated transport in intact mitochondria rather than reconstituted systems would better reflect physiological conditions.

  • Tissue-specific inducible models: Generation of conditional knockout models would allow investigation of acute UCP3 deficiency without developmental compensation .

How should researchers interpret contradictory findings regarding UCP3's uncoupling versus transport functions?

To reconcile seemingly contradictory findings regarding UCP3 function:

  • Context-dependent activity: Consider that UCP3 may exhibit different activities under different experimental conditions or physiological states.

  • Methodological considerations:

    • Reconstituted systems versus isolated mitochondria versus in vivo studies

    • Species differences (human versus rat versus mouse UCP3)

    • Tissue-specific factors that might modify UCP3 function

  • Integrated model: The apparent uncoupling activity might be a secondary consequence of metabolite transport under certain conditions, rather than representing a primary proton transport function.

  • Experimental design recommendations:

    • Include appropriate controls (e.g., R282Q mutant)

    • Directly compare transport versus uncoupling activities in the same experimental system

    • Consider tissue-specific factors that might modify UCP3 function

What are the key experimental considerations when studying UCP3 in animal models of cardiovascular disease?

When investigating UCP3 in cardiovascular disease models:

  • Model selection and characterization:

    • Consider both genetic (UCP3+/- or UCP3-/-) and acquired models (hypertension, heart failure)

    • Full characterization of baseline cardiac function before disease induction

    • Age-matched controls to account for age-dependent changes in UCP3 expression

  • Comprehensive functional assessment:

    • Both systolic and diastolic parameters should be evaluated

    • Serial echocardiography to track disease progression

    • Invasive hemodynamic measurements (e.g., pressure-volume relationships)

    • Combination of in vivo and ex vivo assessments

  • Molecular correlates:

    • Mitochondrial function assessment (respiration, ROS production)

    • Metabolomic analysis to identify altered metabolite profiles

    • Examination of interaction with other metabolic pathways

This integrated approach would provide meaningful insights into UCP3's role in cardiovascular pathophysiology while minimizing confounding factors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.