Recombinant Rat Mitofusin-1 (Mfn1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
Mfn1; Fzo1b; Mitofusin-1; Mitochondrial transmembrane GTPase FZO1B; Transmembrane GTPase MFN1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-741
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPELDRIATEDDLVEIQGY RNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDG DKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSP GTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWD ASASEPEYMEDVRRQHMERCLHFLVEELKVVSPLEARNRIFFVSAKEVLNSRMNKAQGMP EGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVNV AAAEKRVYSMEEREDQIDRLDFIRNQMNLLTMDVKKKIKEVTEEVANKVSCAMTDEICRL SVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLADRCTSEVNASILQSQQEIIENL KPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQEDIVFRFSLGWSSLVHRFLGSTN AQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAAQEELMITLITGLASLTSRTSMGII VVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTTRAKERAFKQQFVNYATEKLQMIVKF TSANCSHQVQQEMATTFARLCQQVDVTQKHLEEEIARLSKEIDQLEKIQNNSKLLRNKAV QLERELENFSKQFLHPSSGES
Uniprot No.

Target Background

Function
Mitofusin-1 (Mfn1) is a mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. Its GTPase activity is necessary for membrane clustering, likely involving significant rearrangement of coiled-coil domains. Mitochondrial morphology is dynamically regulated by the balance between fusion and fission events. Mfn1 overexpression induces the formation of mitochondrial networks in vitro. It exhibits low intrinsic GTPase activity.
Gene References Into Functions
  1. Hypoxia upregulates Mfn1 expression in vivo and in vitro, contributing to hypoxia-induced proliferation of pulmonary artery smooth muscle cells (PASMCs). Mfn1-mediated mitochondrial homeostasis is regulated by miR-125a, which influences PASMCs oxidative phosphorylation and glycolysis. PMID: 28593577
  2. HO-1 upregulation suppresses LPS-induced oxidative stress, potentially through mechanisms involving Mfn1 and the PI3K/Akt pathway. PMID: 27830717
  3. Investigated the role of plant-derived miR5338 in Mfn1 inhibition within the context of rape bee pollen treatment for benign prostatic hyperplasia. PMID: 29382326
  4. In rats with chronic fluorosis, renal Mfn1 protein and mRNA expression decreased, while Fis1 expression increased. PMID: 24958380
  5. Identified MFN1 as an ERK target that modulates mitochondrial morphology and apoptosis. PMID: 25801171
  6. Mfn1 and miR-140 are integrated into the cardiomyocyte apoptosis program. PMID: 24615014
  7. Physical exercise enhances mitochondrial function and the expression of mitofusin, BDNF, and antioxidants in the brain, protecting brain energy metabolism against chronic mild stress. PMID: 22244747
  8. Mfn1 inhibits the activation of caspase-3 and caspase-9, which are essential for endonuclease G translocation to the nucleus. PMID: 20594982
  9. Fis1 and Mfn1 activities influence mitochondrial signaling and, consequently, insulin exocytosis. PMID: 18832378
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family, Mitofusin subfamily
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. In brain, it is expressed at weaker level than MFN2, while it is expressed at a higher level than MFN2 in heart and testis. Expressed at high level in elongating spermatids of seminiferous tubules.

Q&A

What is the biological function of Mitofusin-1 and how does it differ from Mitofusin-2?

Mitofusin-1 is a mitochondrial outer membrane GTPase (approximately 84 kDa) that mediates mitochondrial clustering and fusion. It contains a GTPase domain whose cleavage of GTP is necessary for membrane fusion and a coiled-coil region that mediates protein-protein interactions.

Functionally, Mfn1:

  • Mediates mitochondrial clustering and fusion requiring GTPase activity

  • Has low intrinsic GTPase activity

  • Can induce formation of mitochondrial networks when overexpressed

  • Works with Mfn2 to maintain equilibrium between mitochondrial fusion and fission events

What expression systems are used to produce Recombinant Rat Mitofusin-1 and what are the typical protein specifications?

Recombinant Rat Mitofusin-1 is typically produced using in vitro E. coli expression systems . The full-length protein consists of 741 amino acids and is commonly expressed with an N-terminal 10xHis-tag to facilitate purification .

Key specifications include:

  • Uniprot accession number: Q8R4Z9

  • Molecular weight: Approximately 84 kDa

  • Product type: Transmembrane protein

  • Optimal storage conditions: -20°C, with extended storage at -20°C to -80°C

  • Shelf life: Typically 6 months for liquid form at -20°C/-80°C and 12 months for lyophilized form

For experimental applications, it's advisable to avoid repeated freeze-thaw cycles, with working aliquots recommended to be stored at 4°C for up to one week .

What detection methods are available for Mitofusin-1 in experimental settings?

Several detection methods and reagents are available for Mitofusin-1 research:

Antibody-based detection:

  • Western blotting (WB): Multiple validated antibodies are available for detecting Mfn1 in human, mouse, and rat samples

  • Immunohistochemistry (IHC-P): Some antibodies are validated for paraffin-embedded tissue sections

  • Immunocytochemistry/Immunofluorescence (ICC/IF): For cellular localization studies

  • Flow cytometry: For quantitative analysis of Mfn1 expression in cell populations

  • Immunoprecipitation (IP): For protein-protein interaction studies

Technical considerations:

  • Antibody compatibility with blocking buffers: Some anti-Mfn1 antibodies (e.g., ab126575) are not compatible with milk blocking buffer and require specialized blocking solutions

  • Predicted band size of 84 kDa for Western blotting

  • For specialized applications like studying protein-protein interactions, approaches such as co-immunoprecipitation have been successfully used to study Mfn1 interactions with proteins like RIN1 and Smad2

What experimental models are commonly used to study Mitofusin-1 function?

Several experimental models have been established to study Mfn1 function:

Cell culture models:

  • Mouse embryonic fibroblasts (MEFs): Wild-type and Mfn1 knockout MEFs are commercially available and widely used (e.g., ATCC CRL-2991 and CRL-2992)

  • Neonatal cardiac myocytes: Primary cultures from 1-day-old rats

  • Adult cardiac myocytes: Isolated from 2-month-old rats

  • H4IIE rat cell line and human cell lines like HeLa and Raji

Animal models:

  • Mfn1 knockout mice: Global and tissue-specific knockouts using Cre-loxP systems

  • Conditional knockout models using tamoxifen-inducible Cre systems (e.g., MerCreMer)

  • Cardiac-specific knockouts using promoters like Myh6-cre

  • Lipopolysaccharide (LPS)-induced acute lung injury models in rats for studying Mfn1 in respiratory pathologies

How can site-directed mutagenesis be used to study Mitofusin-1 function?

Site-directed mutagenesis provides valuable insights into Mfn1 structure-function relationships:

Methodological approach:

  • Identify key functional residues based on protein sequence analysis and structural predictions

  • Design primers for QuickChange site-directed mutagenesis or similar techniques

  • Generate mutant constructs (e.g., Mfn1 S86A, S284A, and S290A variants)

  • Sequence verification to ensure no additional mutations

  • Transfect constructs into Mfn1 knockout cells to evaluate functional rescue

Key findings from mutagenesis studies:

  • Phosphorylation site mutations (e.g., S86A, S284A, S290A) have revealed regulatory mechanisms of Mfn1 activity

  • GTPase domain mutations affect membrane fusion capability

  • Coiled-coil domain mutations impact protein-protein interactions and oligomerization

These approaches have demonstrated that Mfn1 GTPase activity is essential for membrane clustering and fusion, while specific phosphorylation events can modulate protein function in response to cellular signals .

How can the GTPase activity of Recombinant Rat Mitofusin-1 be measured in vitro?

Measuring Mfn1 GTPase activity requires specific methodological approaches:

MANT-GTP binding assay:

  • Purify Mfn1 protein from expression systems (e.g., baculovirus/SF21 insect cells)

  • Incubate purified Mfn1 with fluorescent GTP analogue (MANT-GTP)

  • Measure fluorescence enhancement as indicator of nucleotide binding

  • Compare baseline Mfn1 activity to activity in presence of potential regulatory proteins

Research findings:
Studies have shown that Mfn1 alone has minimal MANT-GTP binding capability, but this activity is significantly enhanced (3-4 fold) when Mfn1 is incubated with RIN1, and further enhanced in a complex with Smad2/RIN1 . This indicates that Mfn1 GTPase activity is regulated by protein-protein interactions, particularly with RIN1 which may function as a guanine nucleotide exchange factor (GEF) .

Alternative methods:

  • Colorimetric phosphate release assays

  • Radioactive GTP hydrolysis assays

  • Real-time fluorescence-based assays using environmentally sensitive probes

What are the experimental approaches to study Mitofusin-1 in mitochondrial dynamics and quality control?

Studying Mfn1's role in mitochondrial dynamics requires specialized techniques:

Mitochondrial morphology assessment:

  • Fluorescent labeling of mitochondria (MitoTracker dyes or mitochondria-targeted fluorescent proteins)

  • Confocal or super-resolution microscopy for morphological analysis

  • Quantitative assessment of mitochondrial size, shape, interconnectivity, and distribution

Mitochondrial fusion assays:

  • Photoactivatable fluorescent proteins to track mitochondrial components

  • Cell fusion assays to monitor mixing of differentially labeled mitochondrial populations

  • FRAP (Fluorescence Recovery After Photobleaching) to assess mitochondrial connectivity

Mitochondrial function assessments:

  • Oxygen consumption rate measurements (Seahorse XF analyzers)

  • Membrane potential assays (JC-1, TMRM, or similar dyes)

  • Mitochondrial permeability transition assessments

Research findings:
Studies have shown that Mfn1 and Mfn2 double-knockout leads to resistance to mitochondrial permeability transition (MPT), suggesting a direct relationship between mitochondrial membrane fusion and permeabilization . Additionally, overexpression of Mfn1 induces formation of mitochondrial networks in vitro , while its deletion leads to fragmented mitochondria.

What mechanisms regulate Mitofusin-1 activity and how can these be experimentally investigated?

Mfn1 is regulated through multiple mechanisms that can be investigated through specific experimental approaches:

Protein-protein interaction studies:

  • Co-immunoprecipitation assays to identify Mfn1 binding partners

  • Proximity labeling techniques (BioID, APEX) to capture transient interactions

  • FRET/BRET assays to monitor interactions in living cells

Post-translational modification analysis:

  • Phosphorylation site mapping by mass spectrometry

  • Phospho-specific antibodies to monitor site-specific modifications

  • Phosphomimetic and phospho-dead mutants to assess functional consequences

Research findings:
Studies have identified several key regulatory mechanisms:

  • Smad2-RIN1 complex enhances Mfn1 GTPase activity, with RIN1 functioning as a potential GEF

  • βIIPKC can interact with Mfn1, and selective inhibition of this interaction improves outcomes in heart failure models

  • Heme oxygenase-1 (HO-1) upregulation suppresses oxidative stress induced by LPS, with a mechanism potentially associated with Mfn1 and the PI3K/Akt pathway

How can Recombinant Rat Mitofusin-1 be used in structure-based drug design and therapeutic development?

Recombinant Mfn1 can facilitate drug discovery efforts targeting mitochondrial dysfunction:

Structural characterization approaches:

  • X-ray crystallography of purified Mfn1 domains

  • Cryo-EM analysis of full-length protein or complexes

  • AI-driven conformational ensemble generation

  • Molecular dynamics simulations with AI-enhanced sampling

Drug discovery pipeline:

  • LLM-powered literature research to identify therapeutic significance

  • Binding pocket identification and characterization

  • Druggability assessment of predicted pockets

  • High-throughput screening or virtual screening campaigns

  • Structure-activity relationship studies of identified compounds

Research findings:
Receptor.AI has integrated Mitofusin-1 into their ecosystem as a prospective target with high therapeutic potential . Their approach includes:

  • Comprehensive characterization through AI-powered literature research

  • Conformational ensemble generation through advanced AI algorithms

  • Identification of orthosteric, allosteric, hidden, and cryptic binding pockets

  • Development of structure-based drug design strategies

Studies also indicate that selective inhibition of Mfn1-βIIPKC association improves outcomes in heart failure models, highlighting the therapeutic potential of targeting specific Mfn1 interactions .

What are the methodological considerations for studying Mitofusin-1 in cardiovascular research models?

Cardiovascular studies involving Mfn1 require specialized approaches:

Cardiac-specific genetic manipulation:

  • Tissue-specific promoters (e.g., Myh6-cre) for cardiac-targeted gene deletion

  • Tamoxifen-inducible systems (MerCreMer) for temporal control of gene deletion

  • AAV-based gene delivery for overexpression or knockdown studies

Functional assessments:

  • Echocardiography for in vivo cardiac function (fractional shortening, ejection fraction)

  • Pressure-volume loop analysis for hemodynamic parameters

  • Ex vivo working heart preparations for isolated organ studies

  • Cardiomyocyte contractility measurements

Mitochondrial function in cardiac tissues:

  • High-resolution respirometry on isolated cardiac mitochondria

  • Calcium retention capacity measurements to assess MPT sensitivity

  • ROS production measurements in isolated mitochondria or intact tissues

Research findings:
Studies have demonstrated that:

  • Complete ablation of both Mfn1 and Mfn2 in cardiomyocytes during mid-gestation has profound effects on early postnatal heart function

  • Either Mfn1 or Mfn2 alone (even one functional allele) is sufficient for survival, but monoallelic animals exhibit chamber enlargement and decreased fractional shortening

  • Mitofusins are essential for postnatal metabolic remodeling in the heart

  • Selective inhibition of Mfn1-βIIPKC interaction improves outcomes in heart failure models

How can contradictory findings in Mitofusin-1 research be reconciled through experimental design?

Researchers often encounter seemingly contradictory results when studying Mfn1. Several methodological approaches can help resolve these discrepancies:

Comparative gene deletion strategies:

  • Global vs. tissue-specific knockout models

  • Developmental vs. adult-induced gene deletion

  • Acute vs. chronic gene silencing approaches

Consideration of compensatory mechanisms:

  • Expression analysis of related proteins (e.g., Mfn2, OPA1)

  • Time-course studies following gene manipulation

  • Combined manipulation of multiple fusion/fission proteins

Standardization of experimental conditions:

  • Consistent cell culture conditions and passage numbers

  • Uniform animal housing and handling protocols

  • Standardized assay conditions for mitochondrial function assessment

Research example:
Different studies using Mfn knockout models have reported varying phenotypes. For instance, cardiac ablation of Mfn1 and Mfn2 during embryonic development using Nkx-2.5cre resulted in lethality at approximately E10.5, while using Myh6-cre led to early postnatal lethality . These differences were attributed to the different promoters used: Nkx-2.5cre is active in all cardiac cells (including cardiomyocytes, endothelial, smooth muscle, and mesenchymal cells), while Myh6-cre expression is restricted only to cardiac myocytes .

What is the relationship between Mitofusin-1 and oxidative stress in disease models?

Mfn1 plays complex roles in oxidative stress responses that can be investigated through specific methodological approaches:

Oxidative stress assessment in Mfn1-manipulated models:

  • ROS measurement using fluorescent probes (e.g., DCF-DA, MitoSOX)

  • Antioxidant enzyme activity assays (SOD, catalase, GPx)

  • Lipid peroxidation assessments (MDA, 4-HNE)

  • Protein carbonylation detection

Intervention studies:

  • Antioxidant treatment in Mfn1-deficient models

  • Mfn1 modulation in oxidative stress disease models

  • Combined targeting of mitochondrial dynamics and antioxidant pathways

Research findings:
Studies have shown that:

  • HO-1 upregulation suppresses oxidative stress induced by LPS in acute lung injury models, with mechanisms potentially associated with Mfn1 and the PI3K/Akt pathway

  • Supernatant analysis for malondialdehyde (MDA), superoxide dismutase (SOD), and reactive oxygen species (ROS) in these models suggests that HO-1 modulation affects oxidative stress markers in relation to Mfn1 function

  • Mfn1 and Mfn2 deficiency can affect susceptibility to mitochondrial permeability transition, which is a key process in oxidative stress-induced cell death

This relationship between Mfn1 and oxidative stress pathways presents important opportunities for therapeutic interventions in conditions characterized by mitochondrial dysfunction and oxidative damage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.