Recombinant Rat Mitofusin-2 (Mfn2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Mitochondrial and Cellular Biology

Recombinant Mfn2 is essential for:

  • Mitochondrial Fusion: Mediates outer mitochondrial membrane (OMM) fusion via GTPase activity, working with MFN1 and OPA1 .

  • Mitophagy Regulation: Promotes Parkin translocation and phosphorylation to clear damaged mitochondria .

  • Metabolic Control: Enhances glucose oxidation and respiratory control ratios in skeletal muscle and liver cells .

  • Apoptosis Suppression: Reduces ROS production and stabilizes mitochondrial membrane potential (MMP) under stress .

Table 1: Experimental Insights from Recombinant Mfn2 Studies

Study FocusFindingsSource
Cardiomyocyte ProtectionOverexpression reduced Ang II-induced ROS and apoptosis by 40–60% .
Ovarian FunctionIntraovarian Mfn2 overexpression improved follicle development in rats .
Platelet BiologyMfn2−/− mice exhibited reduced platelet counts and impaired hemostasis .
Autophagosome-Lysosome FusionMFN2 knockdown disrupted autophagy flow in cardiomyocytes .

Applications in Disease Models

Recombinant Rat Mfn2 has been utilized to study:

  • Cardiovascular Diseases: Mitigates ventricular remodeling by enhancing mitochondrial fusion and mitophagy in Ang II-induced injury models .

  • Neurodegeneration: Structural mutations linked to Charcot-Marie-Tooth type 2A impair GTPase activity and mitochondrial tethering .

  • Metabolic Disorders: ΔMfn2 (lacking transmembrane domains) stimulates glucose metabolism independent of fusion activity .

Technical Protocols and Usage Guidelines

Recombinant Mfn2 is validated for multiple applications:

Table 2: Recommended Dilutions for Experimental Use

ApplicationDilution RangeNotes
Western Blot (WB)1:5,000–1:50,000Detected in HepG2, NIH/3T3 cells
Immunohistochemistry (IHC)1:1,000–1:4,000Citrate buffer (pH 6.0) improves yield
Immunofluorescence (IF/ICC)1:50–1:500Optimized for mitochondrial staining

Future Directions

Current research gaps include:

  • Tissue-specific roles of Mfn2 isoforms in metabolic regulation.

  • Therapeutic potential of Mfn2 agonists in mitochondrial disorders.

  • Impact of post-translational modifications on fusion/mitophagy balance.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a particular tag preference, please specify it, and we will prioritize its development.
Synonyms
Mfn2; Fzo1a; Mitofusin-2; Mitochondrial transmembrane GTPase FZO1A; Protein HSG; Transmembrane GTPase MFN2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-757
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSLLFSRCNSIVTVKKDKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESAGFLEDT HRNTELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDK VLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSLVS VMWPNSKCPLLKDGLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQF FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDR IFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQ HTVRAKQIAEAVRLIMDSLHIAAQEQRVYCLEMREERQDRLRFIDKQLELLAQDYKLRIK QMTEEVERQVSTAMAEEIRRLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSD RCSTAIASSLQTMQQDMIDGLKPLLPVSVRNQIDMLVPRQCFSLSYDLNCDKLCADFQED IEFHFSLGWTMLVNRFLGPKNSRRALLGYNDQVQRPLPLTPANPSMPPLPQGSLTQEELM VSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTRAKERA FKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQEIAAMNKK VEALDSLQSKAKLLRNKAGWLDSELNMFIHQYLQPSR
Uniprot No.

Target Background

Function
Mitofusin-2 (Mfn2) is a mitochondrial outer membrane GTPase that plays a crucial role in mitochondrial clustering and fusion. Mitochondria, highly dynamic organelles, rely on the balance between fusion and fission events to determine their morphology. Overexpression of Mfn2 induces the formation of mitochondrial networks. Membrane clustering, dependent on GTPase activity, may involve significant rearrangement of the coiled coil domains. Mfn2 is central to mitochondrial metabolism and potentially linked to obesity and apoptotic processes. It also plays a significant role in regulating vascular smooth muscle cell proliferation. Furthermore, Mfn2 is involved in the clearance of damaged mitochondria through selective autophagy (mitophagy). It is required for the recruitment of parkin (PRKN) to dysfunctional mitochondria. Mfn2 participates in the control of the unfolded protein response (UPR) during ER stress, including the activation of apoptosis and autophagy. It acts as an upstream regulator of EIF2AK3, suppressing its activation under normal conditions.
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family, Mitofusin subfamily
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. In brain, it is more expressed than MFN1, while it is expressed at a weaker level than MFN1 in heart and testis. Expressed at high level in elongating spermatids of seminiferous tubules. Expression is markedly down-regulated in highly prolifer

Q&A

What is Rat Mitofusin-2 and what are its primary functions?

Rat Mitofusin-2 (rMfn2) is an 85-100 kDa transmembrane GTPase protein primarily localized to the outer mitochondrial membrane and endoplasmic reticulum. It belongs to the dynamin family of molecules and is ubiquitously expressed across tissues, with particularly high expression observed in the fallopian tubes, uterus, cardiac muscle, liver, and kidney, but lower expression in adipose tissue . The primary functions of rMfn2 include:

  • Mediating mitochondrial fusion through trans-interactions with Mfn1 and/or Mfn2

  • Facilitating connections between mitochondria and the endoplasmic reticulum

  • Regulating oxidative phosphorylation processes

  • Supporting axonal transport of mitochondria

  • Influencing the expression of respiratory chain components

The protein contains two key functional domains: a GTPase domain that facilitates the fusion process (though with approximately 8-fold lower activity than Mfn1) and a coiled-coil region that mediates the critical protein-protein interactions necessary for its function . Disruptions in Mfn2 function can lead to not only mitochondrial fusion defects but also cell-specific metabolic impairments.

What detection methods are most effective for monitoring recombinant rat Mfn2 expression?

Multiple complementary techniques are recommended for reliable detection of recombinant rat Mfn2 expression:

Detection MethodRecommended DilutionApplication Notes
Western Blotting1:5000-1:50000Most quantitative for protein expression levels
Immunohistochemistry1:1000-1:4000Optimal with TE buffer pH 9.0 for antigen retrieval
Immunofluorescence1:50-1:500Effective for cellular localization studies
Fluorescence MicroscopyN/AUseful for GFP-tagged constructs

For optimal Western blot detection, 50 μg of total protein should be separated on a 10% SDS-PAGE gel and transferred to PVDF membranes . When using fluorescence microscopy for GFP-tagged constructs, both frozen and paraffin-embedded sections should be prepared to ensure comprehensive tissue analysis . The expected molecular weight of rMfn2 is approximately 86 kDa, which serves as a validation point for successful detection .

For time-course studies, expression levels can be detected as early as 7 days post-infection, with expression typically increasing over time, reaching maximum levels around day 45, and maintaining stable expression until at least day 60 post-infection .

How can researchers effectively produce and deliver recombinant rat Mfn2 for in vivo studies?

Lentiviral vector systems have proven highly effective for delivering and expressing recombinant rat Mfn2 in vivo. The methodology involves:

  • Vector Construction: Engineering lentiviral vectors containing the rMfn2 gene, typically with a reporter gene such as GFP for tracking expression (e.g., lenti-GFP-rMfn2) .

  • Viral Titration: Standard viral titers of approximately 2×10^6 tuberculin units virosome have demonstrated successful expression in rat ovarian tissue .

  • Delivery Method: Intraovarian microinjection into the sub-envelope of the target organ has shown high efficiency and specificity . This technique allows for local delivery while achieving systemic expression in multiple tissues.

  • Expression Validation: Monitoring expression using a combination of fluorescence microscopy for GFP signal and Western blotting for quantitative protein assessment is recommended .

  • Controls: Parallel injections with lenti-GFP (without the rMfn2 gene) serve as appropriate controls for experimental validation .

This approach results in significant time-dependent expression, with detectable levels beginning around day 7 post-injection, gradually increasing to reach maximal expression by day 45, and maintaining stable expression through at least day 60 . The advantage of this approach is that it requires only a single minimally invasive injection to achieve long-term stable expression.

What are the key structural domains of rat Mfn2 that researchers should consider in experimental design?

When designing experiments involving recombinant rat Mfn2, researchers should account for these critical structural domains:

  • GTPase Domain (aa 99-258): Located in the cytoplasmic N-terminus, this domain is essential for mitochondrial fusion activity but operates at approximately 8-fold lower activity than the corresponding domain in Mfn1 . Mutations in this region often create non-functional protein.

  • Coiled-Coil Motif (C-terminal, approx. aa 696-738): This domain is crucial for protein-protein interactions, particularly the trans-interactions between Mfn2 and other Mfn proteins that facilitate mitochondrial tethering prior to fusion . Experimental designs targeting or modifying this region will directly impact fusion functionality.

  • Transmembrane Domains: Rat Mfn2 is a two-transmembrane protein with cytoplasmic N- and C-termini . The transmembrane domains anchor the protein to the outer mitochondrial membrane.

  • Cytoplasmic Regions: The large cytoplasmic N-terminus (aa 1-604) contains the functional GTPase domain and is accessible for antibody binding . The region Arg364-Phe599 is particularly well-conserved (93% sequence identity between human and mouse) and serves as an effective antigenic region for antibody production .

When designing recombinant constructs, researchers should note that two potential splice variants have been reported: one with a deletion of aa 245-273, and another with a 33 aa substitution for aa 573-757 that may represent a soluble form of Mfn2 . Experimental design should account for these variants when targeting specific regions of the protein.

What are the tissue-specific expression patterns of recombinant rat Mfn2 following in vivo delivery?

Following lentiviral vector-mediated delivery of recombinant rat Mfn2, distinct tissue-specific expression patterns emerge that researchers should consider when designing experiments:

TissueRelative Expression LevelPattern Observations
Fallopian TubesHighUniform distribution
UterusHighConsistent throughout tissue
Cardiac MuscleHighStrong expression
LiverHighThroughout hepatic tissue
KidneyHighGradient from renal cortex (highest) to renal pyramids (lowest)
OvaryModerateTime-dependent increase
Adipose TissueLowSignificantly lower than control ovary

This differential expression occurs despite the initial targeted delivery to the ovary, indicating systemic distribution of the recombinant protein or viral vector . Western blotting analysis confirms that rMfn2 expression in the fallopian tubes, uterus, cardiac muscle, liver, and kidney is significantly higher compared to control ovary tissues (p<0.01), while expression in adipose tissue remains significantly lower (p<0.01) .

Researchers should account for these expression patterns when designing tissue-specific studies, particularly when comparing effects across different organs. The gradient expression pattern observed in the kidney suggests that even within a single organ, there may be functionally relevant differences in expression levels that could affect experimental outcomes .

How does overexpression of recombinant rat Mfn2 affect reproductive and endocrine function?

Overexpression of recombinant rat Mfn2 in reproductive tissues produces significant endocrine alterations and physiological changes. Research has demonstrated the following effects:

Hormone/ParameterEffect of rMfn2 OverexpressionStatistical Significance
Estradiol (E2)Significant increasep<0.01
Progesterone (P)Significant increasep<0.01
Follicle-stimulating hormone (FSH)No significant changep>0.05
Luteinizing hormone (LH)No significant changep>0.05
Estradiol receptor (ER) expressionIncreasedSignificant
Progesterone receptor (PR) expressionIncreasedSignificant
LH receptor (LHR) expressionNo significant changeNot significant
FSH receptor (FSHR) expressionNo significant changeNot significant
Follicular developmentEnhancedObserved effect

These findings suggest that rMfn2 overexpression selectively impacts local ovarian steroidogenesis without significantly altering pituitary hormone production (FSH and LH). The mechanism appears to involve altered receptor expression for estradiol and progesterone, while gonadotropin receptors remain unaffected . This pattern suggests that rMfn2 may specifically influence downstream steroid hormone pathways without affecting upstream regulatory mechanisms.

When designing experiments targeting reproductive function, researchers should monitor these hormonal parameters using techniques such as radioimmunoassay, while simultaneously assessing receptor expression through Western blotting . These findings highlight the potential therapeutic applications of rMfn2 in reproductive disorders characterized by abnormal follicular development or hormone production.

What methodological considerations are critical when comparing results from different Mfn2 antibodies in experimental workflows?

When utilizing different Mfn2 antibodies across experimental workflows, researchers must address several critical methodological considerations to ensure valid comparisons:

  • Epitope Targeting: Confirm the specific region of Mfn2 targeted by each antibody. For example, antibodies targeting the Arg364-Phe599 region of human Mfn2 (such as those based on accession #O95140) can effectively recognize rat Mfn2 due to high sequence conservation (93% identity) .

  • Cross-Species Reactivity: Verify the documented species reactivity for each antibody. Some antibodies are developed for multi-species detection (human/mouse/rat) while others may have species-specific epitopes .

  • Validated Applications: Ensure antibodies are validated for your specific applications:

    ApplicationValidation Requirements
    Western BlottingConfirmed band at 85-100 kDa; titration from 1:5000-1:50000
    ImmunohistochemistryAntigen retrieval conditions specified (TE buffer pH 9.0 or citrate buffer pH 6.0)
    ImmunofluorescenceCell-type specific visualization at 1:50-1:500 dilution
  • Antibody Class and Host: Consider whether you're using polyclonal or monoclonal antibodies, and from which host species. For example, sheep anti-human/mouse/rat Mfn2 antibodies may require specific secondary antibodies like NorthernLights™ 557-conjugated Anti-Sheep IgG .

  • Protein Preparation Conditions: Standardize protein extraction and preparation methods. For Western blotting, using 50 μg total protein separated on 10% SDS-PAGE gels has been validated .

  • Subcellular Localization: Some antibodies may preferentially detect Mfn2 in specific subcellular locations. For instance, cytoplasmic localization has been documented in skeletal muscle tissue , which should be consistent across antibodies targeting the same epitope.

  • Secondary Detection Systems: Standardize secondary detection systems when possible. When using fluorescent secondary antibodies, counter-staining with DAPI can help normalize detection across samples .

Maintaining detailed records of these parameters for each antibody used will facilitate more accurate cross-study comparisons and troubleshooting of discrepant results.

What are the optimal controls for studies investigating the effects of recombinant rat Mfn2 overexpression?

Establishing proper controls is critical for studies investigating recombinant rat Mfn2 overexpression effects. A comprehensive control strategy should include:

  • Empty Vector Controls: Use identical viral vectors expressing only the reporter gene (e.g., lenti-GFP without rMfn2) to control for vector-related effects . This isolates the specific contribution of rMfn2 from any effects caused by viral infection or reporter gene expression.

  • Uninfected Controls: Include completely uninfected animals/tissues to establish true baseline measurements of all parameters being studied . This controls for both experimental manipulation and vector effects.

  • Time-Matched Sampling: Collect control samples at identical timepoints as experimental samples (e.g., days 7, 15, 30, 45, and 60 post-infection) to account for time-dependent changes .

  • Tissue Panel Controls: When examining multi-tissue effects, include samples from all target tissues in both experimental and control groups, particularly when comparing relative expression levels across tissues .

  • Internal Loading Controls: For protein quantification via Western blotting, use established housekeeping proteins such as β-actin (1:1,000 dilution) as loading controls .

  • Quantitative Standards: For fluorescence microscopy, establish standardized exposure settings and include fluorescence intensity quantification across samples to enable objective comparisons .

  • Functional Readout Controls: Include positive and negative controls for functional assays. For example, when measuring hormonal changes, include samples from animals with known hormonal states as reference points .

  • Specificity Controls: Perform parallel experiments with antibodies directed against different epitopes of Mfn2 to confirm specificity of detected signals .

When reporting results, clearly document all control conditions and include quantitative comparisons between experimental and control groups, with appropriate statistical analysis to determine significance (typically p<0.01 or p<0.05) .

How can researchers troubleshoot inconsistent expression of recombinant rat Mfn2 across different tissues?

When encountering variable expression of recombinant rat Mfn2 across tissues, researchers should implement this systematic troubleshooting approach:

  • Delivery Method Assessment:

    • Confirm consistent viral titer across experimental subjects (recommended: 2×10^6 tuberculin units virosome)

    • Verify injection technique consistency, particularly for targeted organ delivery

    • Consider alternative delivery routes if tissue-specific targeting is required

  • Expression Timeline Analysis:

    • Monitor expression at multiple timepoints (days 7, 15, 30, 45, and 60 post-infection)

    • Different tissues may reach peak expression at different rates

    • Create tissue-specific expression curves to identify optimal sampling windows

  • Detection Method Optimization:

    Tissue TypeRecommended Detection Approach
    Highly vascularized (liver, kidney)Shorter protein extraction time, lower antibody concentration (1:50000 for WB)
    Fibrous tissues (uterus)Extended extraction protocol, higher antibody concentration (1:5000 for WB)
    Adipose tissueSpecialized extraction buffers, longer incubation times
  • Tissue-Specific Protein Extraction:

    • Adjust lysis buffer composition based on tissue type

    • Optimize homogenization protocols (duration, method) for each tissue

    • Consider tissue-specific protease inhibitor cocktails

  • Antibody Selection:

    • Test multiple antibodies targeting different Mfn2 epitopes

    • Verify species reactivity is appropriate for rat Mfn2

    • Adjust antibody concentration based on tissue expression level

  • Tissue-Specific Background Reduction:

    • For immunohistochemistry: Customize blocking procedures for high-background tissues

    • For Western blotting: Adjust wash stringency for different tissue types

    • For fluorescence: Account for tissue-specific autofluorescence

  • Normalization Strategy:

    • Use tissue-appropriate housekeeping genes/proteins as internal controls

    • Consider multiple reference markers for each tissue type

    • Apply tissue-specific normalization factors based on preliminary data

  • Known Expression Pattern Comparison:

    • Compare results with established tissue expression patterns (high in fallopian tubes, uterus, cardiac muscle, liver, and kidney; low in adipose tissue)

    • Use these patterns to calibrate detection sensitivity across tissues

By systematically addressing these factors, researchers can develop tissue-specific protocols that yield more consistent results across different tissue types.

What are the methodological differences between studying endogenous versus recombinant rat Mfn2?

Studying endogenous versus recombinant rat Mfn2 requires distinct methodological approaches to address their unique characteristics:

ParameterEndogenous Mfn2 ApproachRecombinant Mfn2 Approach
DetectionAntibodies against native rat Mfn2; lower signal intensityAnti-tag antibodies or higher signal with anti-Mfn2; GFP fluorescence monitoring possible
Expression LevelPhysiological levels; tissue-dependentSignificantly higher expression; time-dependent increase post-infection
LocalizationNatural subcellular distributionMay show broader distribution or altered localization due to overexpression
RegulationSubject to natural regulatory mechanismsExpression driven by viral promoter; less responsive to natural regulation
Experimental TimelineImmediate analysis possibleRequires waiting period for expression (detectable by day 7, peaks around day 45)
ControlsComparison to knockout or knockdown modelsEmpty vector controls (e.g., lenti-GFP without Mfn2)
Functional StudiesLoss-of-function approaches predominateGain-of-function approaches predominate
Interaction StudiesNatural stoichiometry with binding partnersAltered stoichiometry may create artificial interactions

When studying recombinant Mfn2, researchers should implement specific strategies to distinguish it from endogenous protein:

  • Use epitope tags (His, FLAG, etc.) on recombinant protein

  • Leverage GFP fusion for direct visualization when applicable

  • Compare expression levels to uninfected controls to quantify overexpression magnitude

  • Monitor potential displacement of endogenous protein from normal locations

For functional studies, researchers should be aware that recombinant Mfn2 may compete with endogenous protein for binding partners, potentially creating dominant-negative or hyper-physiological effects that should be carefully interpreted within the experimental context . The significantly higher expression levels of recombinant protein may also saturate normal regulatory mechanisms, resulting in functional outcomes that differ from physiological conditions.

How can researchers effectively study the interaction between rat Mfn2 and other mitochondrial proteins?

To effectively investigate interactions between rat Mfn2 and other mitochondrial proteins, researchers should employ a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP) Optimization:

    • Use antibodies targeting different epitopes of rat Mfn2 to avoid disrupting interaction domains

    • Employ gentle lysis conditions to preserve native protein complexes

    • Consider reversible crosslinking to capture transient interactions

    • Include appropriate negative controls (IgG, irrelevant antibodies)

  • Proximity Ligation Assays (PLA):

    • Particularly useful for detecting endogenous protein interactions in situ

    • Provides spatial resolution of interaction events within the mitochondrial network

    • Can detect interactions between Mfn2 and candidate partners in fixed cells/tissues

  • Fluorescence Resonance Energy Transfer (FRET):

    • Tag Mfn2 and potential binding partners with appropriate fluorophore pairs

    • Especially useful for monitoring dynamic interactions in living cells

    • Can distinguish interactions at ER-mitochondria contact sites versus mitochondria-mitochondria contacts

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein complementation assay to visualize interactions

    • Provides strong signal but potentially stabilizes interactions artificially

  • Domain-Specific Interaction Mapping:

    • Generate constructs expressing specific domains of Mfn2:

      • GTPase domain (aa 99-258)

      • Coiled-coil motif (aa 696-738)

    • Test interaction with full-length partner proteins

  • Mitochondrial Isolation Protocol Optimization:

    • For GTPase activity assays, purify mitochondria under conditions that preserve protein associations

    • Use differential centrifugation combined with density gradient separation

    • Verify mitochondrial fraction purity using organelle-specific markers

  • Quantitative Binding Analysis:

    • Surface Plasmon Resonance (SPR) with purified components

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) for interactions in complex mixtures

  • Functional Correlation Studies:

    • Link protein interactions to functional outputs:

      • Mitochondrial fusion events

      • Changes in cristae morphology

      • Alterations in respiratory chain function

      • Effects on mitochondrial transport in neurons

  • Competition Assays:

    • Use recombinant domains of Mfn2 as competitive inhibitors

    • Determine which interactions are functionally critical

When studying interactions between Mfn2 and other proteins, researchers should be particularly attentive to the known preference for Mfn2 to engage in trans-interactions with both Mfn1 and other Mfn2 molecules, as these interactions are fundamental to its function in mitochondrial fusion . The coiled-coil domain is especially important for these protein-protein interactions and should be preserved in experimental designs .

What translational implications exist when extrapolating rat Mfn2 findings to human applications?

When extrapolating findings from rat Mfn2 studies to human applications, researchers must consider several key translational factors:

  • Sequence Homology Considerations:

    • The region spanning Arg364-Phe599 shares 93% amino acid sequence identity between human and mouse/rat Mfn2

    • Full-length human and rat Mfn2 proteins share approximately 95% sequence identity

    • The GTPase domain (aa 99-258) and coiled-coil motif (aa 696-738) are particularly well-conserved

  • Functional Conservation Assessment:

    • GTPase activity in rat Mfn2 is approximately 8-fold lower than in Mfn1, similar to the relationship in humans

    • Both rat and human Mfn2 form homo-oligomers and hetero-oligomers with Mfn1

    • The trans-interactions mediating mitochondrial fusion appear mechanistically conserved

  • Physiological Differences to Account For:

    ParameterRat ModelHuman ContextTranslational Consideration
    Metabolic RateHigherLowerMay affect mitochondrial dynamics timing
    Tissue-Specific ExpressionHigh in reproductive tissuesVariable across tissuesTarget tissue expression patterns may differ
    Hormonal InfluencesDocumented effects on reproductive hormones Complex hormonal regulationHormonal context varies significantly
    LifespanShorterLongerLong-term effects may differ
  • Experimental Design Translation:

    • Viral vector delivery methods successful in rats (2×10^6 tuberculin units virosome) require scaled dosing for human applications

    • Time-dependent expression profiles (detectable by day 7, peaking around day 45) may have different kinetics in human tissues

    • Tissue-specific expression patterns observed in rats may predict human tissue tropism

  • Disease Model Relevance:

    • Rat models involving Mfn2 overexpression have demonstrated therapeutic potential against tissue damage

    • Similar approaches could potentially be applied to human conditions involving mitochondrial dysfunction

    • Single-injection gene therapy approaches successful in rats offer minimally invasive potential for human applications

  • Regulatory and Safety Considerations:

    • While recombinant vectors show limited cytotoxicity in animal models , human safety profiles require dedicated investigation

    • Species-specific immune responses to viral vectors must be characterized

    • Long-term expression stability observed in rats (stable to day 60) requires validation in human contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.