Recombinant Rat Monocyte to macrophage differentiation protein (Mmd)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Mmd is a transmembrane protein encoded by the Mmd gene (synonyms: Paqr11, Maf). It belongs to the PAQR (Progestin and AdipoQ Receptor) family and is upregulated during macrophage activation . Key roles include:

  • Immune modulation: Enhances TNF-α and nitric oxide (NO) production in macrophages during LPS stimulation .

  • Cellular differentiation: Critical for morphological and functional transitions during monocyte differentiation into macrophages .

Primary Structure

PropertyDetails
UniProt IDQ719N3 (Rat)
Amino Acid SequenceMQFRNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI...HL
DomainsSeven transmembrane domains with homology to ion channel proteins .

Post-Translational Features

  • Expressed in differentiated macrophages but absent in monocytes .

  • Localizes to endoplasmic reticulum, mitochondria, and Golgi apparatus .

Signaling Pathways

  • ERK/Akt Activation: Mmd overexpression enhances phosphorylation of ERK1/2 and Akt, amplifying pro-inflammatory cytokine production (e.g., TNF-α) .

  • Notch Signaling: Expression is modulated by RBP-J, a transcription factor in Notch signaling .

Cellular Effects

  • Promotes macrophage adhesion and morphological complexity .

  • Regulates lysosomal membrane dynamics in microglial activation .

Key Production Parameters

ParameterDetailsSource
Expression SystemE. coli
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose
ApplicationsELISA, Western blot, functional assays

Immune Studies

  • Used to investigate macrophage activation pathways (e.g., LPS-induced inflammation) .

  • ELISA kits (e.g., Human MMA ELISA Kit) leverage recombinant Mmd for biomarker quantification .

Gene Silencing & Overexpression

  • siRNA/shRNA targeting Mmd reduces macrophage adhesion and granularity .

  • Overexpression accelerates macrophage marker expression (CD68, HLA-DRA) .

Table 1: Experimental Insights

Study FocusFindingsSource
LPS ResponseMmd↑ increases TNF-α/NO via ERK/Akt; inhibition reduces cytokines
Cellular LocalizationTagged Mmd localizes to perinuclear regions in NIH3T3 cells
DifferentiationCstF64 knockdown impairs macrophage adhesion and marker expression

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your reconstitution.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
Mmd; Maf; Paqr11; Monocyte to macrophage differentiation factor; Macrophage/microglia activation-associated factor; MAF; Progestin and adipoQ receptor family member 11; Progestin and adipoQ receptor family member XI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mmd
Target Protein Sequence
MQFRNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFIRHL
Uniprot No.

Target Background

Function
Monocyte to macrophage differentiation protein (Mmd) plays a role in the dynamics of lysosomal membranes associated with microglial activation following brain lesions.
Database Links
Protein Families
ADIPOR family
Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Tissue Specificity
Preferentially expressed in the brain.

Q&A

What is Rat Monocyte to Macrophage Differentiation protein (Mmd)?

Rat Mmd is a protein expressed during the differentiation of monocytes into macrophages. It is encoded by the Mmd gene (Gene ID: 303439) in Rattus norvegicus with mRNA reference sequence NM_001007673.1 and protein reference sequence NP_001007674.1 . The protein has seven potential transmembrane domains, suggesting it may function as an ion channel in maturing macrophages rather than as a G-protein coupled receptor, despite its structural characteristics .

What are the key specifications of commercially available recombinant Rat Mmd protein?

Recombinant Rat Mmd protein is typically produced in expression systems such as HEK293 cells. When conjugated to magnetic beads, the specifications include:

ParameterSpecification
SourceHEK293
FormSolution
Particle size~2 μm
Beads SurfaceHydrophilic
Binding Capacity> 200 pmol rabbit IgG/mg beads
Stability≥ 6 months under proper storage
Concentration10mg beads/mL
Storage BufferPBS buffer
Storage Conditions2-8°C, avoid freeze-thaw cycles

These specifications are important to consider when designing experiments involving protein capture and purification .

What are the standard applications for recombinant Rat Mmd protein in research?

Recombinant Rat Mmd protein has multiple research applications, including:

  • Immunoassay development for detection and quantification

  • In vitro diagnostic test development

  • Cell sorting experiments

  • Immunoprecipitation and co-precipitation studies to identify protein-protein interactions

  • Protein and antibody separation and purification

  • Investigation of monocyte-to-macrophage differentiation mechanisms

When designing experiments, researchers should optimize protein concentration based on the specific application, typically starting with manufacturer recommendations and adjusting based on preliminary results.

How should researchers design experiments to study Rat Mmd function during macrophage differentiation?

When investigating Rat Mmd function during macrophage differentiation, consider this methodological approach:

  • Cell Model Selection: Use primary rat monocytes or appropriate cell lines (e.g., NR8383 rat alveolar macrophage cell line).

  • Differentiation Induction: Stimulate cells with differentiation factors such as phorbol 12-myristate 13-acetate (PMA), macrophage colony-stimulating factor (M-CSF), or granulocyte-macrophage colony-stimulating factor (GM-CSF).

  • Temporal Analysis: Collect samples at multiple time points (0h, 24h, 48h, 72h, 96h) to track Mmd expression changes during differentiation.

  • Expression Analysis Method Selection:

    • qPCR for mRNA expression analysis

    • Western blot for protein expression using anti-Mmd antibodies

    • Immunofluorescence for cellular localization studies

  • Functional Validation: Use recombinant Mmd protein coupled to magnetic beads for pull-down assays to identify interaction partners during differentiation .

This approach allows for systematic characterization of Mmd expression patterns and functional relationships during the differentiation process.

What controls should be included when working with recombinant Rat Mmd protein?

A robust experimental design using recombinant Rat Mmd protein should include the following controls:

  • Positive Control: Include a well-characterized protein known to interact with Mmd or a sample with confirmed Mmd expression.

  • Negative Control: Use non-specific proteins of similar size/structure or magnetic beads without conjugated Mmd.

  • Input Control: Analyze a portion of the original sample before any experimental manipulation.

  • Isotype Control: For immunoassays, include an irrelevant protein of the same isotype.

  • Concentration Gradient: Test multiple concentrations of recombinant Mmd to establish dose-dependent effects.

  • Time Course Control: Sample at multiple time points to account for temporal effects.

  • Vehicle Control: Include appropriate buffer controls when adding recombinant protein to experimental systems .

These controls help distinguish specific Mmd-related effects from non-specific or background effects, increasing the reliability of research findings.

How can researchers optimize protein-protein interaction studies using Recombinant Rat Mmd?

To optimize protein-protein interaction studies with recombinant Rat Mmd:

  • Pre-clearing Step: Incubate cell lysates with unconjugated beads to remove proteins that bind non-specifically to beads before adding Mmd-conjugated beads.

  • Buffer Optimization: Test different lysis and binding buffers with varying salt concentrations (150-500 mM NaCl) and detergents (0.1-1% NP-40, Triton X-100) to maximize specific interactions while minimizing background.

  • Cross-linking Consideration: Use reversible cross-linkers like DSP (dithiobis[succinimidyl propionate]) to stabilize transient interactions.

  • Sequential Elution Strategy: Employ sequential elution with increasing stringency to differentiate between strong and weak interactors.

  • Validation by Reciprocal IP: Confirm interactions by immunoprecipitating the suspected binding partner and detecting Mmd.

  • Competitive Binding Assays: Use increasing amounts of non-immobilized recombinant Mmd to compete with immobilized Mmd for binding partners.

  • Mass Spectrometry Analysis: Identify novel binding partners using LC-MS/MS analysis of co-precipitated proteins .

This methodological approach enhances specificity and sensitivity when identifying physiologically relevant Mmd-interacting proteins.

What approaches can be used to study the potential ion channel function of Rat Mmd?

Given that Mmd has been proposed to function as an ion channel protein in maturing macrophages , these methodologies can be employed:

  • Patch-Clamp Electrophysiology: Measure ion currents in cells expressing recombinant Rat Mmd under different voltage conditions to characterize channel properties.

  • Ion Flux Assays: Use fluorescent indicators (e.g., Fluo-4 for Ca²⁺, SBFI for Na⁺) to measure ion flux in response to Mmd expression or activation.

  • Reconstitution in Artificial Membranes: Incorporate purified recombinant Mmd into liposomes or planar lipid bilayers to study its intrinsic channel activity independent of cellular factors.

  • Mutagenesis Studies: Generate point mutations in transmembrane domains to identify residues critical for ion selectivity and conductance.

  • Pharmacological Profiling: Test known ion channel blockers for their effects on Mmd-mediated currents to characterize the channel type.

  • Co-expression with Regulatory Subunits: Identify potential regulatory partners by co-expression studies and measure resulting changes in channel properties.

  • Molecular Dynamics Simulations: Perform in silico modeling of Mmd structure to predict ion pathways and gating mechanisms.

These approaches collectively provide a comprehensive functional characterization of Mmd's proposed ion channel activity.

How should researchers analyze expression patterns of Mmd during monocyte-to-macrophage differentiation?

For robust analysis of Mmd expression during differentiation:

  • Normalization Strategy: Normalize Mmd expression to multiple housekeeping genes (e.g., GAPDH, β-actin, and 18S rRNA) rather than relying on a single reference gene.

  • Statistical Analysis: Apply appropriate statistical tests:

    • ANOVA with post-hoc tests for time course data

    • t-tests for two-condition comparisons

    • Non-parametric alternatives when assumptions of normality are violated

  • Correlation Analysis: Correlate Mmd expression with established macrophage differentiation markers (e.g., CD68, CD11b, F4/80).

  • Multivariate Analysis: Use principal component analysis (PCA) or hierarchical clustering to identify patterns across multiple genes during differentiation.

  • Visualization Techniques: Create heat maps and time-course plots to effectively visualize dynamic expression changes.

  • Biological Replicates: Analyze at least three biological replicates to account for variability.

  • Meta-analysis: Compare results with published datasets on macrophage differentiation to identify conserved patterns .

This comprehensive analytical approach helps establish reliable expression profiles and relationships between Mmd and other differentiation-associated factors.

What are common pitfalls in interpreting results from experiments using recombinant Rat Mmd protein?

Researchers should be aware of these potential pitfalls when interpreting results:

  • Tag Interference: His-tags or other fusion tags may affect protein folding or interactions. Validate key findings with tag-cleaved versions of the protein.

  • Expression System Artifacts: Post-translational modifications may differ between recombinant Mmd from HEK293 cells and native rat macrophage Mmd. Verify critical findings with native protein when possible.

  • Concentration Mismatches: Using non-physiological concentrations of recombinant Mmd may lead to artificial interactions. Titrate protein concentrations and compare with estimated endogenous levels.

  • Buffer Compatibility Issues: Components in storage buffers (e.g., preservatives) may interfere with certain assays. Include buffer-only controls.

  • Batch-to-Batch Variability: Differences between protein preparations can influence results. Use consistent lots for related experiments or validate key findings across multiple lots.

  • Species Differences: Rat Mmd may have different properties than human MMD despite sequence similarity. Exercise caution when extrapolating findings across species.

  • Stability Concerns: Protein degradation during storage or experiments may affect results. Verify protein integrity by SDS-PAGE before critical experiments.

Awareness of these pitfalls allows researchers to design appropriate controls and interpret results with appropriate caution.

How can researchers investigate the structural properties of recombinant Rat Mmd protein?

To characterize the structural properties of recombinant Rat Mmd:

  • Circular Dichroism (CD) Spectroscopy: Determine secondary structure composition (α-helices, β-sheets) and monitor structural changes under different conditions.

  • Fourier-Transform Infrared Spectroscopy (FTIR): Complement CD data for secondary structure analysis, particularly useful for membrane proteins.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For detailed structural analysis of smaller domains or fragments of Mmd.

  • X-ray Crystallography: Attempt crystallization of purified Mmd (challenging for membrane proteins) for high-resolution structural determination.

  • Cryo-Electron Microscopy: Alternative approach for high-resolution structural studies without crystallization.

  • Limited Proteolysis: Identify stable domains and flexible regions by controlled enzymatic digestion followed by mass spectrometry.

  • Molecular Modeling: Generate structural predictions based on homology to proteins with known structures, particularly focusing on the seven transmembrane domains .

This multi-technique approach provides complementary structural information that can inform functional studies and mechanism hypotheses.

What methods can be used to study the regulation of Rat Mmd gene expression?

To investigate the regulation of Rat Mmd gene expression:

  • Promoter Analysis: Clone the Mmd promoter region into reporter constructs (e.g., luciferase) to identify regulatory elements.

  • ChIP-seq: Identify transcription factors binding to the Mmd promoter during monocyte differentiation.

  • CRISPR/Cas9-mediated Genome Editing: Generate specific mutations in promoter or enhancer regions to assess their functional importance.

  • DNA Methylation Analysis: Perform bisulfite sequencing to characterize the methylation status of CpG islands in the Mmd promoter.

  • Histone Modification Profiling: Use ChIP-seq with antibodies against specific histone modifications to map epigenetic changes during differentiation.

  • RNA Stability Assays: Measure Mmd mRNA half-life using actinomycin D to block transcription and monitoring mRNA decay over time.

  • miRNA Regulation: Identify potential miRNA binding sites in the Mmd 3'UTR and validate using reporter assays and miRNA mimics/inhibitors.

These approaches provide a comprehensive understanding of the molecular mechanisms controlling Mmd expression during monocyte-to-macrophage differentiation.

How does Rat Mmd differ from its human ortholog and other species homologs?

Understanding cross-species differences in Mmd is crucial for translational research:

SpeciesUniProt IDSequence Identity to Rat MmdNotable Differences
Rat (Rattus norvegicus)Q719N3100%Reference sequence
Human (Homo sapiens)Q15546~88% (estimated)Different tissue expression pattern
Mouse (Mus musculus)Not specified in search results~95% (estimated)High conservation with rat
Zebrafish (Danio rerio)Not specified in search results~70% (estimated)More divergent sequence

Key comparative insights:

  • Human MMD is expressed in differentiated macrophages but not in freshly isolated monocytes, suggesting conserved function in macrophage differentiation .

  • The protein contains seven transmembrane domains across species, indicating evolutionary conservation of its potential ion channel structure .

  • Species-specific differences may exist in regulatory mechanisms and interaction partners, necessitating caution when extrapolating findings across species.

  • When designing cross-species studies, researchers should account for these differences and validate findings in species-appropriate models .

How can researchers integrate Mmd studies with broader investigations of macrophage biology?

To contextualize Mmd research within the broader field of macrophage biology:

  • Integration with Polarization Studies: Investigate Mmd expression and function in different macrophage phenotypes (M1, M2a, M2b, M2c) to establish its role in functional specialization.

  • Systems Biology Approach: Perform transcriptomic, proteomic, and metabolomic analyses of macrophages with modulated Mmd expression to identify affected pathways.

  • Disease Model Integration: Study Mmd in macrophages from disease models (e.g., atherosclerosis, cancer, infectious diseases) to determine context-specific functions.

  • Comparative Analysis with Other Differentiation Markers: Correlate Mmd expression with established differentiation markers to position it within the differentiation cascade.

  • Single-Cell Analysis: Use single-cell RNA-seq to identify macrophage subpopulations with distinctive Mmd expression patterns.

  • Functional Genomics Screening: Perform CRISPR screens to identify genes that functionally interact with Mmd during differentiation.

  • Tissue-Resident Macrophage Studies: Compare Mmd expression and function across different tissue-resident macrophage populations to identify tissue-specific roles.

This integrative approach places Mmd research within the broader context of macrophage biology and increases its translational relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.