Recombinant Rat Mu-type opioid receptor (Oprm1)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Mu-type opioid receptor

The Mu-type opioid receptor, also known as OPRM1, is a 60-70 kDa variably glycosylated G protein-coupled receptor that mediates the biological effects of many alkaloid and peptide opioids including morphine . This receptor plays a central role in pain modulation, reward processing, and various physiological responses to both endogenous and exogenous opioid compounds. As a seven-transmembrane domain receptor, OPRM1 transduces signals across cell membranes, initiating complex intracellular cascades that ultimately produce analgesia, euphoria, sedation, respiratory depression, and reduced intestinal motility .

The rat OPRM1 (accession number P33535) serves as an important model for investigating opioid receptor function across species. Its expression pattern is primarily neuronal, with significant presence in the brain, spinal cord, and gastrointestinal tract, as well as on certain immune cells . This distribution pattern aligns with the diverse physiological effects mediated by opioid signaling throughout these systems.

Following agonist binding, OPRM1 undergoes phosphorylation and internalization, processes that contribute significantly to the development of opioid tolerance and desensitization . This regulatory mechanism has profound implications for understanding the challenges associated with long-term opioid therapy, including diminished efficacy and dependence.

Molecular Structure and Protein Characteristics

The rat Mu-type opioid receptor exhibits the characteristic architecture of G protein-coupled receptors, with seven transmembrane domains connected by intracellular and extracellular loops. Western blot analysis of rat OPRM1 typically reveals a specific band at approximately 70 kDa under reducing conditions, reflecting its molecular weight after post-translational modifications . This glycosylation pattern contributes to the receptor's functional diversity and influences its trafficking, ligand binding properties, and signaling capabilities.

A notable feature of OPRM1 is its ability to form heterodimers with several other G protein-coupled receptors. These include the delta-type Opioid Receptor, Nociceptin/Orphanin Receptor, Neurokinin 1 Receptor, Somatostatin Receptor 2, Cannabinoid Receptor 1, CCR5, and the alpha 2A-Adrenergic Receptor . These heterodimeric associations create additional complexity in receptor pharmacology and potentially offer novel targets for therapeutic intervention with improved selectivity profiles.

The protein's C-terminal region, which interacts with intracellular signaling machinery, shows considerable variability due to alternative splicing of the Oprm1 gene. This structural diversity may contribute to different signaling outcomes depending on the specific variant expressed in particular tissues or cellular contexts.

Gene Structure and Transcriptional Complexity

Recent advanced sequencing technologies, including Oxford Nanopore Sequencing and spatial transcriptomics, have revealed significant insights into the transcriptional landscape of the Oprm1 gene. Contrary to earlier annotations in genomic databases, the primary Oprm1 transcript features a much longer structure than previously recognized, with a 3' terminus located at approximately position 6,860,027 on chromosome 10, which is about 9.5 kilobases downstream of the longest previously annotated exon 4 end .

The gene structure typically includes conserved exons 1-3 encoding the core transmembrane domains and a highly variable 3' region encoding part of the protein C-terminus and the 3' UTR. Historical reports suggested potential alternative start sites (exons 1 & 11), though contemporary evidence indicates limited significant expression of these variants .

Tissue Distribution and Expression Patterns

The expression pattern of OPRM1 has been extensively characterized using multiple complementary techniques, including in situ hybridization, RNA sequencing, and immunohistochemistry. In rat neural tissues, OPRM1 is prominently expressed in specific regions that align with its functional roles in pain modulation and reward processing.

Immunohistochemical studies using specific antibodies have demonstrated OPRM1 localization in the dorsal horn of the rat spinal cord, a region critically involved in nociceptive processing . Fluorescent immunohistochemistry reveals that μ-opioid receptor staining is specifically localized to the dorsal horn when using anti-rat μ-opioid receptor monoclonal antibodies . This expression pattern corresponds with the receptor's essential role in modulating pain signals at the first synapse in the pain pathway.

At the cellular level, single-cell RNA sequencing analyses indicate that Oprm1 is expressed primarily in neurons, with particularly strong expression in parvalbumin-positive, somatostatin-positive, and VIP-positive neuronal populations . The mean coverage for conserved Oprm1 exons 1-3 was measured at 0.4192 per neuron, while expression in non-neuronal cells remained near the detection threshold . This neuronal specificity aligns with the receptor's principal functions in modulating neural transmission and neurophysiological processes.

Research Applications and Detection Methods

Recombinant rat OPRM1 and antibodies targeting this receptor constitute essential tools for investigating opioid receptor biology. Western blot analysis using specific monoclonal antibodies, such as MAB86291, can detect OPRM1 in rat spinal cord tissue with a characteristic band at approximately 70 kDa . These antibodies typically recognize epitopes in the receptor sequence with high specificity, enabling precise localization and quantification in various experimental contexts.

Immunohistochemistry applications further demonstrate the utility of anti-OPRM1 antibodies for visualizing receptor distribution in fixed tissue sections. For example, fluorescent immunohistochemistry using rabbit anti-rat μ-opioid receptor monoclonal antibodies (e.g., MAB8629) at 1 μg/mL can effectively detect the receptor in perfusion-fixed frozen sections of rat spinal cord . When coupled with appropriate fluorescent secondary antibodies, such as NorthernLights 557-conjugated anti-rabbit IgG, this approach enables detailed visualization of receptor localization in relation to other cellular markers.

The availability of recombinant OPRM1 standards and specific antibodies facilitates numerous research applications, including:

  1. Pharmacological screening of novel opioid compounds with potential therapeutic benefits

  2. Investigation of molecular mechanisms underlying opioid tolerance, dependence, and addiction

  3. Exploration of receptor trafficking and regulation under various physiological and pathological conditions

  4. Characterization of receptor-ligand interactions at the structural and functional levels

  5. Development of targeted approaches for pain management with reduced side effect profiles

Future Research Directions

Recent discoveries regarding the transcriptional complexity of the Oprm1 gene have important implications for future research trajectories. The identification of the predominant ultralong 3' UTR variant suggests potential regulatory mechanisms that could influence receptor expression, trafficking, and function in ways not previously recognized . This extended untranslated region may contain regulatory elements that interact with RNA-binding proteins or microRNAs to modulate translation efficiency, mRNA stability, or subcellular localization.

Despite earlier hopes that transcript diversity might enable the development of subtype-selective opioid drugs, current evidence indicates that the majority of OPRM1 receptors share similar structural characteristics . This finding suggests that developing selective ligands based solely on transcript diversity may be more challenging than previously anticipated, necessitating alternative approaches to achieve improved therapeutic profiles.

Emerging research directions may include further characterization of heterodimeric interactions between OPRM1 and other receptors, which could potentially offer novel pharmacological targets with distinct signaling properties. Additionally, investigation of the functional significance of the ultralong 3' UTR may reveal new regulatory mechanisms that could be exploited for therapeutic purposes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please specify your needs when placing the order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Oprm1; Ror-b; Mu-type opioid receptor; M-OR-1; MOR-1; Opioid receptor B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
Uniprot No.

Target Background

Function
The Mu-type opioid receptor (OPRM1) serves as a receptor for endogenous opioids like beta-endorphin and endomorphin. It also binds to natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin, and methadone. Agonist binding to the receptor triggers coupling to an inactive GDP-bound heterotrimeric G-protein complex. This interaction leads to the exchange of GDP for GTP in the G-protein alpha subunit, resulting in the dissociation of the G-protein complex. The free GTP-bound G-protein alpha and the G-protein beta-gamma dimer subsequently activate downstream cellular effectors. The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3, and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extent to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15. These interactions mediate a range of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K), and regulation of NF-kappa-B. OPRM1 also couples to adenylate cyclase stimulatory G alpha proteins. The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17, and RGS4. Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins are involved in short-term receptor desensitization. Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein, terminating signal transduction. The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits, which involves beta-arrestins. The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation. OPRM1 acts as a class A G-protein coupled receptor (GPCR) that dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling. Receptor down-regulation pathways vary with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis, and recycling. Heterooligomerization with other GPCRs can modulate agonist binding, signaling, and trafficking properties. OPRM1 is involved in neurogenesis.
Gene References Into Functions
  1. A study discovered that early life repetitive procedures, whether tactile or noxious, affect the intensity of OPRM1-immunoreactivity in the superficial spinal cord dorsal horn after injury in adulthood, without altering baseline expression. PMID: 29473323
  2. HDAC2 expression was upregulated during the course of chronic pancreatitis pain induction, while muopioid receptor activity in the thoracic spinal dorsal horn was significantly suppressed. PMID: 29257262
  3. Results provide further evidence for the role of accumbens shell mu-opioid receptors, but not kappa-opioid receptors, in mediating reinforcing effects of EtOH and in regulating EtOH consumption. PMID: 27508965
  4. OPRM1 expression and function are higher in the NAc of sedentary rats selectively bred for high voluntary running behavior than rats selectively bred for low voluntary running behavior. Findings suggest that inherent differences in Oprm1 action and downstream dopaminergic signaling may influence inherited physical activity behavior. PMID: 27743985
  5. A study demonstrates that in the rat model, endometriosis can be associated with a decrease in mu opioid receptors (MOR) immunoreactivity within neuronal compartments in addition to a shift in MOR and N-methyl-d-aspartate subunit receptor (NR1) receptor expression within the ventral periaqueductal gray. PMID: 27089914
  6. Results suggest that mu opioid receptor-induced suppression of excitatory propagation in the insular cortex is an underlying mechanism of the powerful analgesic effects of mu opioid receptor agonists. In contrast, delta opioid receptors may play a minor role in suppressing acute pain. PMID: 27246300
  7. The findings provide evidence for the existence of MOR on the cell membrane, sarcoplasmatic reticulum, and mitochondria in left ventricular cardiomyocytes in rats. However, heart failure does not result in an altered expression of the cardiac MOR-opioid system. PMID: 26686371
  8. Data show that preconception exposure of morphine to female adolescent animals affects their offspring's response to morphine in a sex-specific manner, which may be mediated in part by differential expression of the mu opioid receptor in the nucleus accumbens and ventral tegmental area. PMID: 26700246
  9. Findings indicate that G9a contributes critically to transcriptional repression of MORs in primary sensory neurons in neuropathic pain. G9a inhibitors may be used to enhance the opioid analgesic effect in the treatment of chronic neuropathic pain. PMID: 26917724
  10. Results suggested that the high nightly voluntary running distance expressed by female rats selectively bred for running motivation is mediated by increased endogenous mu-opioid receptor signaling in the nucleus accumbens. PMID: 26044640
  11. Activation of the mu opioid receptor (MOR) causes GTP to bind to and activate Go (alphaobetagamma). PMID: 26119705
  12. Smaller cardiovascular responses to stimulation of m1-opioid receptors by endomorphin-2 can be explained by lower expression of M1OR mRNA in the Medial Ncleus sSlitarius of Spontaneously Hypertensive Rats compared to Wistar Kyoto rats. PMID: 25051156
  13. Mu-opioid and 5-HT1A receptors cooperatively act to regulate escape behavior. PMID: 25315826
  14. K303 in the mu opioid (MOP) receptor is important in conferring selectivity for covalent binding of beta-funaltrexamine. PMID: 25481857
  15. A study demonstrated that OPRM1 activation attenuated Abeta oligomers-induced neurotoxicity in primary cultured cortical neurons through mTOR signaling. PMID: 25146548
  16. The results of this study suggested that upregulation of VTA MOR is necessary for the behavioral and biochemical changes induced by social defeat stress. PMID: 25446676
  17. This study demonstrated that EM2- and SP-containing terminals and GABAergic neurons in the mouse spinal dorsal horn. PMID: 24718557
  18. These results suggest a synergic interaction between the 5-HT1A and the mu-opioid receptor at the post-synaptic level on neurons of the dorsal periaqueductal grey that regulate proximal defense, theoretically related to panic attacks. PMID: 23598399
  19. Our data demonstrate that mu-delta heteromer signaling does not desensitize and is regulated differently from mu- and delta-receptor signaling following prolonged morphine treatment. PMID: 24976397
  20. Testosterone plays a key role in the regulation of mu-opioid receptor in trigeminal ganglia under inflammatory conditions. PMID: 23801566
  21. Fever induced by HIV-glycoprotein 120 is regulated by mu-type opioid receptors. PMID: 24120859
  22. Data indicate 3-methoxythiophen-2-yl)methyl]({2-[(9R)-9-(pyridin-2-yl)-6-oxaspiro-[4.5]decan-9-yl]ethyl})amine (TRV130) as a selective, and G protein biased mu opioid receptor agonist. PMID: 24063433
  23. The association of FKBP12 with OPRM1 attenuates the phosphorylation of the receptor and triggers the recruitment and activation of PKCepsilon. PMID: 24113748
  24. Endomorphin 2 and mu-opioid receptor might be involved in both the homeostatic control and information transmission of micturition. PMID: 23671582
  25. Reduction of mu opioid receptor signaling attenuates cocaine and heroin seeking behavior. PMID: 23299095
  26. The truncated single transmembrane variants can dimerize with the full-length 7-TM mu-opioid receptor (MOR-1) in the endoplasmic reticulum, leading to increased expression of MOR-1 at the protein level. PMID: 23760268
  27. Results implicate mu-opiate receptors in the central nucleus of the amygdala in a positive regulation of sodium intake. PMID: 23270855
  28. Activation of both mu and delta opioid receptors relieves both heat-induced and mechanically induced pain. PMID: 23843537
  29. miR-134 participated in inflammatory pain by balancing the expression of MOR1 in dorsal root ganglia. PMID: 22865422
  30. Activated mu-opioid receptors are at least partly capable of turning pulmonary C-fiber-mediated, rapid-shallow breathing into an apneic state. PMID: 22796630
  31. A fragment flanking the 5'-end of the GABArho1 gene suffices to drive transcription in the inner nuclear layer of the retina during early postnatal development. PMID: 23106126
  32. In high drinking animals, the anticipation of ethanol is characterized by distinct behaviors, increased exploration and novelty-seeking, and by a specific neurochemical phenotype, greater expression of ENK and MOR within the medial prefrontal cortex. PMID: 22703995
  33. These results suggest that thioredoxin-1 may play a role in the actions of morphine. PMID: 22732447
  34. Suggest that opioids acting on mu-receptors in the rostral medullary raphe exert an excitatory modulation of hyperventilation induced by hypoxia. PMID: 21827637
  35. Ghrelin interacts with neuropeptide Y Y1 and opioid receptors to increase food reward. PMID: 22210742
  36. A subset of rostral ventromedial medulla neurons expressing mu-opioid receptors contributes to the maintenance of thermal hyperalgesia in neuropathic pain. PMID: 21238509
  37. Mu opioid receptor activation has profound effects on the temporal integration between two primary excitatory pathways in the CA1 hippocampal region. PMID: 21056047
  38. Chronic ethanol drinking alters the ability of MOR to endocytose in response to opioid peptides, and consequently, promotes tolerance to the effects of opioids. PMID: 21602922
  39. MOR was expressed in rat brain neostriatum in both the marginal division as well as in patches, but with different morphological characteristics. These differences in MOR immunoreactivity indicated potential functional differences between them. PMID: 21631922
  40. Activation of mu-opioid receptors in nucleus accumbens shell increased feeding on a sweetened-fat diet. PMID: 20562021
  41. Mu-Opioid receptor stimulation in the nucleus accumbens elevates fatty tastant intake by increasing palatability and suppressing satiety signals. PMID: 21543633
  42. The identification of the rat exon 11 and its associated variants further demonstrated conservation of 5' splicing in OPRM1 genes among rodents and humans. PMID: 21255438
  43. Data suggest that multiple reproductive experiences influence both gene activity and kappa, mu, and delta opioid receptor expression in the periaqueductal gray. PMID: 20574683
  44. Glycosylation at the N53 site of the rat mu-opioid receptor does not influence the function of this receptor significantly. PMID: 20592872
  45. These findings demonstrate that delta-opioid receptor activation selectively inhibits inputs activated by icilin, whereas mu-opioid receptor activation has a more widespread effect on synaptic inputs to neurons in the superficial dorsal horn. PMID: 20977770
  46. Spinal cord MOR/KOR heterodimers represent a unique pharmacological target for female-specific pain control. PMID: 21041644
  47. Results suggest that modulation of the delta-opioid receptor 2, but not mu receptor, expression and its synaptic localization may constitute a viable therapeutic approach to disrupt morphine-induced conditioned responses. PMID: 20626460
  48. Data show that mu and kappa opioid receptors are expressed as mRNA and translated into specific receptor proteins on cardiac parasympathetic, sympathetic, and sensory neurons as potential binding sites for opioids. PMID: 20653037
  49. Coexistence of delta-opioid receptors and mu-opioid receptors in small dorsal root ganglia neurons is a basis for direct interaction of opioid receptors in modulation of nociceptive afferent transmission and opioid analgesia. PMID: 20615975
  50. These results suggest that in rat sphenopalatine ganglion neurons, activation of M2 mAChR likely modulates mu (micro) opioid receptors transmission in the brain vasculature to adequately maintain cerebral blood flow. PMID: 19889856

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Perikaryon. Cell projection, dendrite. Endosome.
Tissue Specificity
Brain. Is expressed in the cerebral cortex, caudate putamen, nucleus accumbens, septal nuclei, thalamus, hippocampus, and habenula. Not detected in cerebellum.

Q&A

What is the molecular structure and basic properties of rat Oprm1?

Rat Mu-type opioid receptor (Oprm1) is a 60-70 kDa variably glycosylated G protein-coupled receptor (GPCR) with seven transmembrane domains. It is encoded by the Oprm1 gene with accession number P33535. The receptor protein exhibits considerable sequence homology with other species, sharing 94% amino acid sequence identity with human MOR and 98% with mouse MOR . The receptor is primarily expressed as a multi-pass membrane protein located in the cell membrane, with significant presence in axons, perikaryon, dendrites, and endosomes .

Unlike previous assumptions, recent transcriptional analyses have revealed that the primary transcript of the receptor is substantially longer than current reference sequences annotated in genomic databases, containing an over 10,000-base-long noncoding sequence at the 3' terminus .

What is the tissue distribution pattern of Oprm1 in the rat nervous system?

Rat Oprm1 is predominantly expressed in neurons throughout the central nervous system, with significant expression in:

  • Brain regions associated with pain modulation and reward processing

  • Spinal cord, particularly in the dorsal horn, which is critical for pain transmission

  • Gastrointestinal tract neurons

  • Select populations of immune cells

Immunohistochemical studies using specific antibodies have demonstrated that within the spinal cord, MOR is localized to the dorsal horn, an area crucial for nociceptive processing . Western blot analysis shows robust expression in rat spinal cord tissue, with negligible expression in rat cerebellar tissue (which serves as a negative control in many experimental paradigms) .

What are the principal signaling pathways associated with rat Oprm1 activation?

Rat Oprm1 activation initiates a complex cascade of signaling events primarily through G-protein coupling. The receptor exhibits:

  • Primary G-protein coupling: Predominantly couples to pertussis toxin-sensitive Gi/Go G-alpha proteins (GNAI1, GNAI2, GNAI3, and GNAO1 isoforms Alpha-1 and Alpha-2), and to a lesser extent to pertussis toxin-insensitive G-alpha proteins (GNAZ and GNA15) .

  • Downstream effectors: Activation triggers multiple cellular responses including:

    • Inhibition of adenylate cyclase activity

    • Inhibition of N-type and L-type calcium channels

    • Activation of inward rectifying potassium channels

    • Stimulation of mitogen-activated protein kinase (MAPK) pathway

    • Activation of phospholipase C (PLC)

    • Regulation of phosphoinositide/protein kinase C (PKC)

    • Modulation of phosphoinositide 3-kinase (PI3K) signaling

    • Regulation of NF-kappa-B activity

  • Desensitization mechanisms: Upon agonist binding, the receptor undergoes phosphorylation by G protein-coupled receptor kinases (GPRKs), followed by β-arrestin association, which uncouples the receptor from G-proteins, terminating signal transduction. The phosphorylated receptor is subsequently internalized through endocytosis via clathrin-coated pits involving β-arrestins .

What are the most reliable methods for detecting and quantifying rat Oprm1 in tissue samples?

Multiple validated techniques exist for the detection and quantification of rat Oprm1:

Western Blot Analysis:

  • Optimal protocol involves using PVDF membranes probed with specific antibodies such as Rabbit Anti-Rat μ Opioid R/OPRM1 Monoclonal Antibody

  • Typical detection shows a specific band at approximately 70 kDa

  • Best performed under reducing conditions using appropriate immunoblot buffer systems

Immunohistochemistry/Immunofluorescence:

  • For frozen tissue sections, perfusion fixation followed by immunostaining with specific antibodies (e.g., MAB8629 at 1 μg/mL overnight at 4°C)

  • Secondary antibody detection systems like NorthernLights™ 557-conjugated Anti-Rabbit IgG with DAPI counterstaining

  • In spinal cord samples, specific staining is typically localized to the dorsal horn

ELISA-based Quantification:

  • Sandwich ELISA methods with detection ranges of 31.2-2000 pg/mL and sensitivity of approximately 15.65 pg/mL

  • Suitable for serum, plasma, tissue homogenates, and cell culture supernatants

  • Typical inter-assay and intra-assay CV values of 7.0% and 4.8%, respectively

RNA Detection Methods:

  • RNAscope for sensitive in situ detection of Oprm1 mRNA

  • Hybridization Chain Reaction Fluorescence In Situ Hybridization (HCR-FISH) for high-sensitivity detection and colocalization studies

  • RNA-seq for comprehensive transcriptional analysis of variant expression

How can researchers generate and validate recombinant Oprm1 expression systems?

Generation of Recombinant Expression Systems:

  • CRISPR-Cas9 Genetic Modification:

    • Design sgRNAs targeting specific regions of the Oprm1 gene (optimally with tools like CRISPR design algorithm)

    • For reduced off-target effects, utilize Cas9 'nickase' (D10A mutant) with offset guide RNAs directed to opposite strands

    • Include inhibitors of non-homologous end-joining (like SCR7) to increase homology-based repair efficiency

    • For reporter systems, insert T2A cleavable peptide and Cre recombinase downstream of the last exon (exon 4)

  • Knock-in Rat/Mouse Model Development:

    • CRISPR-based Oprm1-Cre knock-in models allow cell type-specific genetic access to MOR-expressing cells

    • These models maintain endogenous expression and function while enabling molecular characterization

Validation Approaches:

  • Expression Analysis:

    • Compare Oprm1 expression between recombinant and wild-type systems using RNAscope and RNA-seq

    • Assess coexpression patterns (e.g., iCre and Oprm1 should show 95-98% coexpression in properly designed systems)

  • Receptor Binding Studies:

    • Perform autoradiography to assess MOR receptor density

    • Compare binding profiles between recombinant and control tissues

  • Functional Validation:

    • Assess receptor function through agonist-induced G-protein coupling assays

    • Evaluate downstream signaling pathway activation

    • For in vivo models, test physiological responses like pain sensitivity, morphine analgesia, and opioid tolerance development

What considerations are important when developing antibodies against rat Oprm1?

When developing antibodies for rat Oprm1 research, several critical factors should be considered:

Epitope Selection:

  • Target unique, accessible regions of the receptor

  • Avoid sequences with high homology to other opioid receptors (delta and kappa) to prevent cross-reactivity

  • Consider targeting extracellular domains for applications requiring detection of cell-surface receptors, or intracellular domains for detecting total receptor populations

Antibody Format and Species:

  • Monoclonal antibodies typically offer higher specificity but may recognize only a single epitope

  • Polyclonal antibodies provide broader epitope recognition but may have batch-to-batch variation

  • For rat Oprm1, rabbit-derived antibodies have demonstrated good specificity and utility in multiple applications

Validation Requirements:

  • Western blot validation should show a specific band at approximately 70 kDa in tissues known to express Oprm1 (spinal cord) and absence in negative control tissues (cerebellum)

  • Immunohistochemical validation should demonstrate expected localization patterns (e.g., dorsal horn of spinal cord)

  • Knockout or knockdown controls are essential to confirm specificity

  • Cross-validation with multiple detection methods provides stronger evidence of specificity

Application Optimization:

ApplicationRecommended Optimization Approach
Western BlotTest antibody concentrations between 0.1-1.0 μg/mL; optimize blocking and wash conditions
IHC/ICCTest fixation methods; typically effective at 1 μg/mL overnight at 4°C
Flow CytometryRequires extensive titration and validation with proper controls
IPVerify efficiency using Western blot of precipitated material

How do genetic variants of Oprm1 affect receptor function and response to opioids?

Recent research has revealed important insights regarding Oprm1 genetic variants:

Transcriptional Variants:

  • The primary transcript of rat Oprm1 is substantially longer than previously annotated, with an over 10,000-base-long noncoding sequence at the 3' terminus

  • Several alternative transcripts exist but represent only approximately 15% or less of the total transcript content in examined brain regions

  • This suggests that targeting different subpopulations of receptors based on transcript variants may be challenging

Functional Implications:

  • The μ-opioid receptor shows heterogeneous responses to synthetic opioids, with incomplete cross-tolerance after chronic exposure to selective μ-opioid agonists

  • This has led to speculation about functionally different receptor isoforms, though recent structural and transcriptional analyses suggest the differences may be more subtle than previously thought

  • The existence of alternative transcripts contributes to the ongoing debate about MOR subtypes and their differential responses to various opioid ligands

Sex-Based Differences:

  • Studies using Oprm1-Cre knock-in rats have demonstrated sex differences in the response to modulation of MOR-expressing cells

  • Specifically, lesioning NAc MOR-expressing cells had different effects on heroin self-administration in male versus female rats:

    • In males, lesions primarily affected acquisition of heroin self-administration

    • In females, there was a stronger inhibitory effect on the effort to self-administer heroin

  • These findings suggest sex-specific functional roles of MOR-expressing cells in reward and addiction processes

How can Oprm1-Cre transgenic rat models advance our understanding of opioid receptor function?

The development of Oprm1-Cre transgenic rat models represents a significant advancement in opioid research methodology:

Experimental Capabilities:

  • Cell-Type Specific Manipulations: These models allow precise genetic access to MOR-expressing cells, enabling:

    • Selective activation or inhibition using optogenetic or chemogenetic approaches

    • Cell-specific ablation studies using Cre-dependent apoptotic vectors (e.g., AAV1-EF1a-Flex-taCasp3-TEVP)

    • Targeted gene expression or deletion in MOR-expressing neurons only

  • Circuit Mapping and Analysis:

    • Visualization of MOR-expressing neural circuits using Cre-dependent reporter expression

    • Tracing of inputs to and outputs from MOR-expressing cells

    • Electrophysiological characterization of identified MOR-expressing neurons

Research Applications:

  • Addiction Studies: The validated Oprm1-Cre knock-in rat enables investigation of:

    • Cell-specific contributions to opioid reward and reinforcement

    • Neural circuits underlying addiction and withdrawal

    • Sex differences in opioid addiction mechanisms

  • Pain Research:

    • Dissection of MOR-expressing cell contributions to pain perception and modulation

    • Investigation of cell-type specific mechanisms of opioid analgesia

    • Studies of tolerance development at the cellular level

  • Molecular Characterization:

    • Cell-type specific transcriptomics and proteomics

    • Analysis of signaling pathway activation in specifically identified MOR-expressing cells

    • Characterization of receptor trafficking and regulation in vivo

The advantage of these models is that they maintain endogenous expression patterns and receptor function while providing selective experimental access to the cells of interest, offering a significant improvement over traditional pharmacological approaches or constitutive knockout models .

What methodologies are used to study biased agonism at the rat Oprm1 receptor?

Biased agonism (or functional selectivity) at opioid receptors has become a critical area of research for developing safer analgesics. Several methodological approaches are employed:

Signaling Pathway Assays:

Structural Assessment Approaches:

  • Molecular Dynamics Simulations:

    • Development of homology models of MOR that remain conformationally stable in control MD simulations

    • Comparison of receptor conformational changes induced by different ligands

    • Analysis of how these conformational changes relate to downstream signaling biases

  • Receptor-Ligand Binding Studies:

    • Docking simulations to predict binding poses (achieving RMSDs of 0.4-0.7 Å from crystallographic positions)

    • Analysis of ligand-dependent receptor conformation stability (with RMSDs of 1.8-2.8 Å)

    • Evaluation of ligand binding pose stability (with RMSDs of 1.7-2.2 Å)

Correlating In Vitro and In Vivo Measures:

  • Strong correlations have been found between measures of efficacy for receptor activation, G protein coupling, and β-arrestin recruitment for some MOR agonists, including those previously described as biased

  • Studies measuring antinociceptive and respiratory depressant effects of MOR agonists have shown that low intrinsic efficacy of some opioid ligands can explain their improved side effect profile, potentially independent of signaling bias

What are common challenges in detecting and characterizing rat Oprm1 in experimental systems?

Researchers frequently encounter several challenges when working with rat Oprm1:

Detection Challenges:

  • Antibody Specificity Issues:

    • Cross-reactivity with other opioid receptor subtypes (delta and kappa)

    • Non-specific binding to other G-protein coupled receptors

    • Solution: Use validated monoclonal antibodies with demonstrated specificity, such as those that show a single band at the expected molecular weight (approximately 70 kDa) and proper localization patterns

  • Variable Glycosylation Patterns:

    • The receptor's 60-70 kDa size range reflects variable glycosylation

    • This can result in diffuse bands or multiple bands in Western blot analysis

    • Solution: Consider enzymatic deglycosylation before analysis for more consistent results

  • Low Expression Levels:

    • Natural expression levels can be below detection thresholds in some tissues

    • Solution: Use more sensitive detection methods (Super-signal chemiluminescence for Western blots, amplification systems for IHC, or RNAscope for mRNA)

Functional Characterization Challenges:

  • Receptor Internalization and Trafficking:

    • Rapid internalization after agonist binding complicates surface expression studies

    • Solution: Use fixed timepoints and temperature controls to standardize internalization conditions

  • Heterologous Expression System Limitations:

    • Recombinant systems may lack necessary cellular machinery for proper receptor function

    • Solution: Validate findings in native tissue or primary neuronal cultures when possible

  • Heterodimer Formation:

    • OPRM1 forms heterodimers with several other GPCRs (DOR, ORL1, NK1, SSTR2, CB1, CCR5, ADRA2A)

    • These interactions can alter pharmacology and signaling properties

    • Solution: Consider co-expression analyses and use appropriate controls when studying receptor pharmacology

How can researchers effectively differentiate between Oprm1 splice variants in experimental systems?

Differentiating between Oprm1 splice variants requires specialized approaches:

RNA-Based Detection Methods:

  • RT-PCR with Variant-Specific Primers:

    • Design primers that span unique exon junctions or target specific exons

    • Optimize annealing temperatures for high specificity

    • Use nested PCR for low-abundance variants

    • Validate amplicon identity through sequencing

  • RNA-Seq Analysis:

    • Employ deep sequencing approaches to comprehensively identify all transcript variants

    • Use specific bioinformatics pipelines designed to detect and quantify alternative splicing events

    • Recent research has shown that alternative transcripts represent approximately 15% or less of total Oprm1 transcript content in brain regions

  • Hybridization Chain Reaction (HCR-FISH):

    • This technique can provide cellular resolution of specific variants

    • Studies have demonstrated high coexpression levels (95-98%) between specific transcripts

Protein-Based Detection Methods:

  • Variant-Specific Antibodies:

    • Generate antibodies against unique epitopes in specific variants

    • Validate specificity using overexpression systems and knockout controls

    • Use in Western blotting and immunohistochemistry for variant localization

  • Mass Spectrometry:

    • Use targeted proteomics approaches to identify variant-specific peptides

    • Requires careful sample preparation and high-sensitivity instruments due to low abundance of some variants

Functional Differentiation:

  • Pharmacological Profiling:

    • Different variants may show subtle differences in ligand binding or signaling properties

    • Design assays that can detect these differences in binding affinity, G-protein coupling, or β-arrestin recruitment

  • Cell-Based Reporter Assays:

    • Express individual variants in cell lines with appropriate readout systems

    • Compare signaling patterns in response to various agonists

Despite these methodological approaches, recent research suggests that targeting different subpopulations of receptors based on transcript variants may be challenging due to the predominance of the main transcript form .

What control experiments are essential when studying rat Oprm1 signaling pathways?

When investigating rat Oprm1 signaling pathways, several control experiments are critical for reliable interpretation:

Receptor Specificity Controls:

  • Pharmacological Controls:

    • Include selective MOR antagonists (e.g., CTAP, β-FNA) to confirm receptor specificity

    • Test effects in the presence of antagonists for related receptors (delta and kappa) to rule out off-target effects

    • Use structurally diverse agonists to confirm consistent pathway activation patterns

  • Genetic Controls:

    • When available, use Oprm1 knockout or knockdown models as negative controls

    • For knockdown approaches, include scrambled siRNA/shRNA controls

    • In Oprm1-Cre models, compare with wildtype littermates to control for genetic background effects

Signaling Pathway Controls:

  • Positive Controls for Pathway Activation:

    • Include direct activators of downstream signaling components

    • For G-protein pathways: include GTPγS as a direct G-protein activator

    • For MAPK pathways: include growth factors known to activate these pathways

  • Pathway Inhibitor Controls:

    • Use selective inhibitors of specific signaling components (e.g., pertussis toxin for Gi/o-coupled pathways)

    • Include concentration-response curves for inhibitors to demonstrate specificity

    • Validate pathway inhibition using positive control activators

Methodological Controls:

  • Temporal Controls:

    • Include multiple time points to capture both rapid and delayed signaling events

    • For desensitization studies, include washout and recovery periods to assess reversibility

  • Expression Level Controls:

    • In recombinant systems, normalize for receptor expression levels

    • Use techniques like radioligand binding to quantify receptor density

    • When comparing between conditions or treatments, ensure equivalent receptor expression

Technical Validation:

Control TypePurposeImplementation
Vehicle ControlsAccount for solvent effectsMatch solvent composition and concentration
Temperature ControlsControl for temperature-dependent processesMaintain consistent temperature during experiments
Time ControlsAccount for time-dependent changesInclude time-matched untreated samples
Cell Passage ControlsControl for changes due to repeated passagingUse cells within a defined passage range

These control experiments help ensure that observed effects are specifically due to Oprm1 activation and not artifacts or non-specific effects, which is particularly important given the complex signaling networks associated with this receptor .

How are new genetic tools advancing our understanding of circuit-level functions of Oprm1-expressing neurons?

Recent developments in genetic tools have revolutionized our ability to study Oprm1-expressing neurons at the circuit level:

Transgenic Models and Their Applications:

  • Oprm1-Cre Knock-in Models:

    • CRISPR-based Oprm1-Cre knock-in rats and mice provide unprecedented genetic access to MOR-expressing cells

    • These models maintain endogenous receptor expression patterns and function

    • Enable cell-type specific manipulations through Cre-dependent technologies

  • Circuit Mapping Technologies:

    • Cre-dependent viral tracers allow identification of inputs to and outputs from MOR-expressing neurons

    • Monosynaptic rabies virus tracing can reveal direct presynaptic partners

    • Anterograde tracers identify projection targets of MOR-expressing cells

Functional Circuit Analysis:

  • Optogenetic and Chemogenetic Approaches:

    • Cell-specific expression of opsins or Designer Receptors Exclusively Activated by Designer Drugs (DREADDs)

    • Enables temporal control of MOR-expressing neuron activity in behaving animals

    • Allows causal testing of circuit hypotheses in complex behaviors

  • In Vivo Calcium Imaging:

    • Cre-dependent expression of GCaMP allows monitoring of MOR-expressing neuron activity during behavior

    • Fiber photometry or miniature microscopes can track population or single-cell activity

    • Reveals how these neurons encode and process information during opioid-related behaviors

Research Findings from These Approaches:

  • Circuit-Specific Roles in Addiction:

    • Studies using Oprm1-Cre rats have demonstrated that lesioning NAc MOR-expressing cells affects heroin self-administration

    • Sex differences were observed in these effects, with males showing altered acquisition and females demonstrating changes in motivation/effort

  • Cell-Type Specific Transcriptomics:

    • Single-cell RNA sequencing of MOR-expressing neurons enables molecular classification of cellular subtypes

    • Reveals molecular diversity within the MOR-expressing population that may underlie functional heterogeneity

These genetic approaches have transformed our understanding from a receptor-centric view to a cell-type and circuit-level understanding of how MOR-expressing neurons contribute to behavior, revealing previously unappreciated complexity and specificity in opioid-related neural circuits .

What are the emerging approaches for studying Oprm1 receptor dynamics and trafficking?

Research into Oprm1 receptor dynamics and trafficking has advanced significantly with new methodological approaches:

Advanced Imaging Techniques:

  • Super-Resolution Microscopy:

    • Techniques like STORM, PALM, and STED overcome the diffraction limit of conventional microscopy

    • Allow visualization of receptor clustering, internalization, and trafficking at nanoscale resolution

    • Can detect changes in receptor organization upon agonist binding and during desensitization

  • Live-Cell Imaging Approaches:

    • Fluorescent protein tagging of Oprm1 enables real-time tracking of receptor movement

    • SNAP/CLIP-tag technologies allow pulse-chase labeling to distinguish surface vs. internalized populations

    • FRAP (Fluorescence Recovery After Photobleaching) measures lateral mobility and membrane retention

Molecular Biosensors:

  • Conformational Sensors:

    • FRET/BRET-based sensors report on receptor conformational changes

    • Can detect subtle differences in receptor states induced by different ligands

    • Help explain mechanisms of biased agonism at the structural level

  • Signaling Biosensors:

    • Genetically-encoded biosensors for various second messengers (cAMP, Ca²⁺, DAG)

    • Allow spatiotemporal resolution of signaling events in living cells

    • Reveal compartmentalized signaling within specific cellular microdomains

Biochemical and Molecular Approaches:

  • Site-Specific Receptor Modifications:

    • CRISPR-mediated introduction of phosphorylation-deficient mutations

    • Analysis of how specific phosphorylation sites affect trafficking and desensitization

    • Creation of receptors with altered internalization or recycling properties

  • Interactome Analysis:

    • Proximity labeling approaches (BioID, APEX) identify proteins near the receptor

    • Mass spectrometry-based identification of the dynamic receptor interactome

    • Reveals how the receptor's protein interaction network changes during activation, desensitization, and trafficking

These emerging approaches are providing unprecedented insights into the dynamic nature of Oprm1 receptor regulation, helping to explain phenomena like tolerance, dependence, and the differential effects of various opioid drugs .

How does the understanding of rat Oprm1 contribute to translational research on pain and addiction?

Rat Oprm1 research has significant translational implications for human health, particularly in pain management and addiction treatment:

Translational Relevance of Rat Models:

  • Species Similarities:

    • Rat MOR shares 94% amino acid sequence identity with human MOR

    • Similar pharmacological profiles and anatomical distribution patterns

    • Comparable responses to opioid drugs make rat models particularly valuable for translational research

  • Advantages of Rat Models:

    • Rats display complex behaviors relevant to pain and addiction that can be difficult to model in mice

    • The larger size of rats facilitates certain experimental manipulations and sample collection

    • Novel genetic tools like Oprm1-Cre rats bridge the gap between molecular mechanisms and behavior

Applications in Pain Research:

  • Mechanism-Based Therapeutic Development:

    • Studies of OPRM1 signaling bias inform development of analgesics with reduced adverse effects

    • Understanding of tolerance mechanisms guides approaches to prevent or delay analgesic tolerance

    • Identification of key cellular populations involved in opioid analgesia enables targeted interventions

  • Sex Differences in Pain and Analgesia:

    • Research using Oprm1-Cre models has revealed sex-specific functions of MOR-expressing cells

    • These findings help explain clinical observations of sex differences in pain perception and analgesic responses

    • May guide sex-specific therapeutic approaches for pain management

Addiction Research Applications:

  • Circuit-Based Understanding of Addiction:

    • Studies using Oprm1-Cre rats have identified specific roles of NAc MOR-expressing cells in heroin self-administration

    • Sex differences in these functions provide insights into the neurobiology of addiction vulnerability

    • This understanding could inform targeted interventions for addiction treatment

  • Biomarker Development:

    • Characterization of Oprm1 variants and their functional consequences may help identify biomarkers for addiction risk or treatment response

    • ELISA and other quantification methods developed for rat Oprm1 can be adapted for human studies

    • Potential for personalized approaches to addiction treatment

Future Translational Directions:

Research AreaTranslational PotentialKey Methodologies
Biased AgonismDevelopment of safer analgesicsSignaling pathway-specific screening, MD simulations
Circuit ManipulationTargeted neuromodulation therapiesOprm1-Cre models, optogenetics/chemogenetics
Genetic VariationPersonalized medicine approachesTranscriptional analysis, functional characterization
Sex DifferencesSex-specific therapeutic strategiesComparative studies in male and female models

The continued refinement of our understanding of rat Oprm1 through advanced genetic, molecular, and behavioral approaches is creating new opportunities for translational applications in treating pain and addiction disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.