Recombinant Rat Mucin-4 (Muc4)

Shipped with Ice Packs
In Stock

Description

Structure and Function

MUC4 consists of two subunits, MUC4α and MUC4β, formed by autocatalytic cleavage at a Gly-Asp-Pro-His (GDPH) site . The MUC4α subunit is a large, extracellular N-terminal subunit characterized by a tandem repeat (TR) domain, along with NIDO and AMOP domains . The smaller, membrane-tethered C-terminal subunit MUC4β includes a truncated vWD domain, three EGF-like domains, and a cytoplasmic tail .

The N-terminal of MUC4 contains a signal peptide of 27 residues, followed by three imperfect repetition motifs varying in size from 126 to 130 residues and a unique sequence of 554 residues. These sequences are followed by a central domain comprised of a variable number of 16 residue perfect tandem repetition motifs, a unique feature of the human MUC4 mucin . The carboxy-terminal of MUC4 is composed of 12 distinct domains (CT1–CT12) .

MUC4 protects epithelial surfaces and promotes their regeneration and repair . Overexpression of SMC masks the surface antigens on target tumor cells and effectively suppresses tumor cell killing by cytotoxic cells .

Role in Disease

MUC4 is implicated in several diseases, particularly in cancer and inflammatory conditions .

  • Cancer: MUC4 is often overexpressed in cancers, such as cholangiocarcinoma (CCA), where it promotes gemcitabine resistance and an unfavorable prognosis . MUC4 mediates gemcitabine resistance by activating AKT signaling in GR CCA cells . High MUC4 expression promotes EGFR and HER2 activation to mediate gemcitabine resistance .

  • Colitis: Studies using Muc4−/− mice have demonstrated its role in intestinal inflammation and inflammation-associated tumorigenesis . Muc4 −/− mice displayed increased resistance to DSS-induced colitis compared with wild-type (WT) littermates .

  • Nephrolithiasis: MUC4 was found to have an influence on the process of nephrolithiasis and was upregulated in the CaOx nephrolithiasis model rats . Silencing of MUC4 can inactivate the ERK signaling pathway and further restrain oxidative stress and CaOx crystal formation in RTEC .

Research Findings

Research has explored MUC4's involvement in various biological processes and diseases:

  • Gemcitabine Resistance: MUC4 confers gemcitabine resistance and an unfavorable prognosis in cholangiocarcinoma (CCA) . MUC4 protein expression was upregulated in GR CCA sublines in whole-cell lysates and conditioned media . In CCA patients, the expression of MUC4 in GEM-based chemotherapy-treated patients with partial response (PR) or stable disease (SD) was lower than its expression in GEM-based chemotherapy-treated patients with progressive disease (PD) .

  • Oxidative Stress and Calcium Oxalate Crystal Formation: Silencing of MUC4 can inactivate the ERK signaling pathway and further restrain oxidative stress and CaOx crystal formation in RTEC . MUC4 silencing or ERK signaling pathway inactivation may decrease the formation of CaOx crystals .

  • Experimental Colitis and Colitis-Associated Colorectal Cancer: Muc4 −/− mice were viable and fertile with no apparent defects . Muc4 −/− mice displayed increased resistance to DSS-induced colitis compared with wild-type (WT) littermates .

MUC4 as a Therapeutic Target

Given its involvement in cancer and other diseases, MUC4 represents a potential therapeutic target . The MUC4β region is considered functionally important as it has 3 EGF-like domains that interact with HER-2 and promote cancer cell proliferation . A recombinant human MUC4β-based polyanhydride nanovaccine has the potential to be an effective immunotherapeutic modality against PC and other MUC4-overexpressing malignancies .

Tables of Relevant Data

Table 1: MUC4 Expression and Progression-Free Survival in CCA Patients

VariableHazard Ratio95% Confidence IntervalP-value
High MUC4 Expression2.151.12-4.140.021
Lung Metastasis2.331.20-4.540.012
Bone Metastasis1.680.87-3.250.126
Peritoneum Metastasis1.490.77-2.880.232
Differentiation (Poor vs. Well)1.220.63-2.370.556

This table shows that CCA patients undergoing chemotherapy with high expressions of MUC4 had an inferior PFS compared with that of CCA patients with low MUC4 expression .

Table 2: MUC4 Expression and AKT Phosphorylation in TAA-induced Rat CCA Tissues

GroupMUC4 ExpressionAKT Thr308 Phosphorylation
TAA-induced CCA TissuesUpregulatedUpregulated
Remaining Tumor TissuesUpregulatedUpregulated

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Muc4; Smc; Mucin-4; MUC-4; Ascites sialoglycoprotein; ASGP; Pancreatic adenocarcinoma mucin; Pre-sialomucin complex; pSMC; Sialomucin complex; Testis mucin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1616-2344
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Muc4
Target Protein Sequence
DPHITTLDNAKYTFNGLGYFLLVQAQDRNSSFLLEGRTAQTDSANATNFIAFAAQYNTSS LKSPITVQWFLEPNDTIRVVHNNQTVAFNTSDTEDLPVFNATGVLLIQNGSQVSANFDGT VTISVIALSNILHASSSLSEEYRNHTKGLLGVWNDNPEDDFRMPNGSTIPSNTSEETLFH YGMTSETNGIGLLGVRTDPLPSEFTPIFLSQLWNKSGAGEDLISGCNEDAQCKFDILATG NRDIGQSTNSILRTFRHVNGTLNQYPPPIHYSSKIQAYKGREQWPLRSPATLRMSYSASP TSAVAFELFENGSLHVDTNIPRRTYLEILARDVKTNLSSVLQPETVACFCSKEEQCLYNE TSKEGNSSTEVTSCKCDGNSFGRLCEHSKDLCTEPCFPNVDCIPGKGCQACPPNMTGDGR HCVAVEISEFCQNHSCPVNYCYNHGHCDISGPPDCQPTCTCAPAFTGNRCFLAGNNFTPI IYKELPLRTITLSLREDENASNADVNASVANVLENLDMRAFLSNSLVELIRTSPGAPVLG KPIHHWKVVSHFKYRPRGPLIHYLNNQLISAVMEAFLLQARQERRKRSGEARKNVRFFPI SRADVQDGMALNLSMLDEYFTCDGYKGYHLVYSPQDGVTCVSPCSEGYCHNGGQCKHLPD GPQCTCATFSIYTSWGERCEHLSVKLGAFFGILFGALGALLLLAILACVVFHFCGCSMNK FSYPLDSEL
Uniprot No.

Target Background

Function

Mucin-4 (MUC4) is a transmembrane mucin, a highly glycosylated protein family comprising the major component of mucus, the viscous secretion coating epithelial surfaces. These glycoproteins are crucial for epithelial protection and are implicated in epithelial renewal and differentiation. MUC4 regulates cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and its function as an intramembrane ligand for ERBB2. It plays a significant role in epithelial cell proliferation and differentiation by inducing specific ERBB2 phosphorylation. In polarized epithelial cells, MUC4 segregates ERBB2 and other ERBB receptors, preventing ERBB2 from acting as a coreceptor. Interaction with ERBB2 leads to increased CDKN1B expression. However, the formation of a MUC4-ERBB2-ERBB3-NRG1 complex downregulates CDKN1B, repressing apoptosis and stimulating proliferation. Its tumor-promoting effects are primarily attributed to apoptosis repression rather than enhanced proliferation.

Subcellular Location
[Mucin-4 beta chain]: Cell membrane; Multi-pass membrane protein.; [Mucin-4 alpha chain]: Secreted.
Tissue Specificity
Expression is developmentally regulated in the mammary gland, dramatically increases in the lactating gland compared with the virgin mammary gland, while decreasing again during mammary gland involution. Expressed in 13762 ascites cells. Overexpressed in

Q&A

What is the basic structure of Rat Mucin-4 and how does it compare to human MUC4?

Rat Mucin-4 (Muc4) is a large membrane-bound glycoprotein with a complex multi-domain structure. Similar to human MUC4, it consists of two primary subunits: a large mucin-type alpha subunit (ASGP1) and a membrane-associated beta subunit (ASGP2). The structure includes a signal peptide followed by repetition motifs and a central domain comprised of tandem repetitions. The GDPH (Gly-Asp-Pro-His) proteolytic cleavage site, which is fully conserved across species, separates these two functional subunits .

The tandem repeat domain shows significant interspecies variation. While human MUC4 contains 16 amino acid repeats occurring 146-500 times, rat Muc4 contains 117-124 amino acid repeats occurring only 12 times . This structural difference indicates potential functional variations that should be considered when designing experiments using rat models to study human conditions. The transmembrane beta subunit contains EGF-like domains that facilitate interactions with various signaling molecules, influencing cellular processes such as proliferation and differentiation .

What are the primary physiological functions of Rat Mucin-4 in normal tissues?

Rat Mucin-4 serves multiple physiological functions in normal tissues. It plays a critical role in cell signaling and protection of epithelial surfaces, serving as both a physical barrier and a signaling molecule . In normal physiology, Muc4 functions in cell adhesion regulation through its anti-adhesive properties, which influence cell-cell and cell-extracellular matrix interactions .

Muc4 also acts as an intramembrane ligand for ERBB2 (HER2), inducing specific phosphorylation that triggers downstream signaling cascades affecting cell proliferation and differentiation of epithelial cells . Additionally, in polarized epithelial cells, Muc4 participates in the segregation of ERBB2 and other ERBB receptors, contributing to the maintenance of normal epithelial architecture and function . These functions collectively highlight Muc4's importance in maintaining tissue homeostasis and cellular communication in various rat tissues including urothelium, trachea, lung, and testis .

How is Rat Mucin-4 gene expression regulated under normal and pathological conditions?

Rat Mucin-4 gene expression is subject to complex regulatory mechanisms that vary between normal and pathological states. Under normal conditions, Muc4 expression is tissue-specific and developmentally regulated. In pathological conditions such as nephrolithiasis, Muc4 becomes significantly upregulated, as demonstrated in rat models of calcium oxalate (CaOx) nephrolithiasis .

The regulation pathway involves several key factors. Drawing parallels from studies on human MUC4, the retinoic acid receptor-α signaling pathway plays a crucial role, with TGFβ2 serving as an interim mediator . In addition, the extracellular signal-regulated kinase (ERK) signaling pathway has been identified as a significant regulatory mechanism, with Muc4 acting as an activator of this pathway in epithelial cells . Under pathological conditions, such as in kidney stone formation, this upregulation contributes to increased oxidative stress and calcium oxalate crystal formation in renal tubular epithelial cells (RTEC) . Understanding these regulatory mechanisms is essential for researchers developing targeted interventions for conditions involving Muc4 dysregulation.

What are the optimal methods for producing and purifying Recombinant Rat Mucin-4?

Producing and purifying Recombinant Rat Mucin-4 presents significant challenges due to its large size, extensive glycosylation, and complex domain structure. Based on established protocols, the recommended approach involves a multi-step process:

  • Expression System Selection: Mammalian expression systems (particularly Chinese Hamster Ovary or HEK293 cells) are preferred over bacterial systems for recombinant Muc4 production, as they provide the post-translational modifications necessary for proper protein folding and function .

  • Vector Design: Vectors should include appropriate promoters (e.g., CMV) and selection markers. For functional studies, it's advisable to incorporate epitope tags (His, FLAG, or HA) to facilitate purification and detection without interfering with protein function .

  • Purification Strategy: A two-phase purification approach is recommended, beginning with affinity chromatography (if tagged) followed by size-exclusion chromatography. For experiments requiring high purity, ion-exchange chromatography can be added as an intermediate step .

  • Quality Control: Verification of purified recombinant Muc4 should include Western blotting, glycosylation analysis, and functional assays to confirm that the recombinant protein maintains its biological properties .

For researchers interested in studying specific domains rather than the full-length protein, expression of individual functional domains (particularly the EGF-like domains) has proven more manageable and may be sufficient for many signaling studies .

What detection and quantification methods are most reliable for Rat Mucin-4 in different sample types?

The detection and quantification of Rat Mucin-4 require different approaches depending on the sample type and research objective. The following methods have demonstrated reliability across various experimental settings:

  • ELISA Assays: Sandwich ELISA has emerged as the gold standard for quantifying Muc4 in serum, plasma, and cell culture supernatants. Commercial kits offer detection ranges of 0.156-10 ng/mL with sensitivity as low as 0.074 ng/mL . When selecting antibodies, those targeting the non-tandem repeat regions provide more consistent results across different splice variants.

  • Western Blotting: For tissue lysates and cell extracts, Western blotting with monoclonal antibodies (such as 1G8) that recognize conserved epitopes in Muc4 of mouse, rat, and human origin provides reliable detection . Due to the large size of Muc4, standard protocols should be modified to use low percentage gels (3-5%) and extended transfer times.

  • Immunohistochemistry/Immunofluorescence: For tissue sections, immunohistochemistry with paraffin-embedded sections (IHCP) using specific antibodies enables visualization of Muc4 localization and expression patterns . This approach is particularly valuable for studying the distribution of Muc4 in different tissue compartments.

  • RT-qPCR: For gene expression analysis, RT-qPCR remains the most sensitive method for quantifying Muc4 mRNA levels. Primer design should account for the various splice variants to ensure comprehensive detection .

When comparing results across different studies, it's essential to consider the detection method used, as each technique has different sensitivity, specificity, and potential limitations.

What are effective strategies for silencing Rat Mucin-4 gene expression in experimental models?

Silencing Rat Mucin-4 gene expression requires careful consideration of the experimental model and research objectives. Based on successful protocols reported in the literature, the following strategies have proven effective:

  • RNA Interference (RNAi): Short interfering RNA (siRNA) targeting conserved regions of the Muc4 mRNA can achieve transient knockdown. For in vivo studies, recombinant plasmids expressing Muc4-specific siRNA have been successfully used to downregulate Muc4 expression in Wistar rat-based models of nephrolithiasis . The optimal target regions are outside the variable tandem repeat domain to ensure consistent knockdown efficiency.

  • CRISPR-Cas9 Gene Editing: For permanent knockout models, CRISPR-Cas9 targeting of early exons in the Muc4 gene provides a more stable alternative to RNAi. This approach has been particularly valuable for studying long-term effects of Muc4 deficiency in cellular and animal models.

  • Antisense Oligonucleotides: Modified antisense oligonucleotides designed to target Muc4 pre-mRNA can effectively reduce expression by interfering with mRNA processing and stability.

  • Small Molecule Inhibitors: While not directly silencing gene expression, inhibitors of the ERK signaling pathway can effectively counteract Muc4-mediated effects, as demonstrated in studies showing that both Muc4 silencing and ERK pathway inhibition produced similar physiological outcomes .

For validation of knockdown efficiency, a combination of RT-qPCR, Western blot analysis, and functional assays is recommended to confirm both mRNA and protein reduction, as well as the expected phenotypic changes .

How does Rat Mucin-4 contribute to kidney stone formation and renal pathology?

Rat Mucin-4 plays a significant role in kidney stone formation through several interconnected mechanisms. Research using rat models of calcium oxalate (CaOx) nephrolithiasis has demonstrated that Muc4 is upregulated in this condition and contributes to pathogenesis through multiple pathways .

Mechanistically, Muc4 activates the extracellular signal-regulated kinase (ERK) signaling pathway in renal tubular epithelial cells (RTEC), promoting oxidative stress that facilitates calcium oxalate crystal formation . This activation leads to increased levels of oxidative stress markers such as H₂O₂ and malondialdehyde (MDA), while simultaneously decreasing antioxidant enzyme activities including glutathione peroxidase (GSH-Px), catalase (CAT), and superoxide dismutase (SOD) .

The relationship between Muc4 and stone formation is further evidenced by experimental interventions targeting Muc4. Silencing of Muc4 gene expression in rat models resulted in reduced oxalic acid and calcium contents in urine, decreased blood urea nitrogen (BUN), creatinine (Cr), Ca²⁺, and P³⁺ levels in serum, and downregulation of p-ERK1/2, monocyte chemoattractant protein-1 (MCP-1), and osteopontin (OPN) expressions in RTEC . These findings establish Muc4 as a potential therapeutic target for preventing or treating nephrolithiasis.

What is the relationship between Rat Mucin-4 and cancer progression in experimental models?

Rat Mucin-4 exhibits significant associations with cancer progression in experimental models, primarily through its effects on cellular signaling, adhesion, and apoptosis regulation. Drawing from both rat-specific studies and broader Muc4 research, several oncogenic mechanisms have been identified:

  • Anti-apoptotic Activity: Muc4 promotes tumor progression primarily through the repression of apoptosis rather than direct proliferative effects. This anti-apoptotic action provides a survival advantage to cancer cells, allowing tumor growth and persistence .

  • ERBB2 Signaling: Muc4 acts as an intramembrane ligand for ERBB2 (HER2), inducing specific phosphorylation that activates downstream signaling pathways critical for cancer cell survival and proliferation . The β subunit of Muc4 has been identified as an oncogene that engages signaling pathways responsible for tumor initiation and progression .

  • Cell Adhesion Modulation: The anti-adhesive properties of Muc4 affect cell-cell and cell-extracellular matrix interactions, potentially facilitating cancer cell detachment, migration, and metastasis .

  • Immune Evasion: Though less studied in rat models, Muc4 may contribute to tumor immune evasion by masking surface antigens, a function consistent with its normal protective role on epithelial surfaces.

These mechanisms position Muc4 as an important factor in cancer biology, with potential implications for developing targeted therapies. The specific role of Muc4 appears to be context-dependent, varying across different cancer types and stages.

How does the interaction between Rat Mucin-4 and the ERK signaling pathway influence oxidative stress responses?

The interaction between Rat Mucin-4 and the ERK signaling pathway creates a significant regulatory axis for oxidative stress responses in various tissues. This relationship has been particularly well-characterized in renal tubular epithelial cells (RTEC) in the context of kidney stone formation .

Muc4 functions as an activator of the ERK signaling pathway, with experimental evidence showing that upregulated Muc4 correlates with increased phosphorylation of ERK1/2 (p-ERK1/2) . This activation triggers a cascade of cellular responses that affect the oxidative balance:

  • Increased ROS Production: Activated ERK signaling downstream of Muc4 promotes the generation of reactive oxygen species (ROS), including hydrogen peroxide (H₂O₂), contributing to oxidative stress conditions .

  • Antioxidant Suppression: The Muc4-ERK axis suppresses key antioxidant enzymes including glutathione peroxidase (GSH-Px), catalase (CAT), and superoxide dismutase (SOD), further exacerbating oxidative stress .

  • Inflammatory Mediator Expression: This signaling promotes the expression of inflammatory mediators such as monocyte chemoattractant protein-1 (MCP-1) and osteopontin (OPN), which contribute to tissue damage and pathological changes .

Experimental manipulation of this pathway through either Muc4 silencing or direct ERK pathway inhibition effectively reduces oxidative stress markers and increases antioxidant enzyme levels . This relationship presents a potential therapeutic target for conditions characterized by oxidative stress, particularly in epithelial tissues where Muc4 is normally expressed.

How can splice variants of Rat Mucin-4 be identified and what are their functional implications?

Identifying and characterizing splice variants of Rat Mucin-4 requires a systematic approach due to the complexity of the Muc4 gene. Based on comparative analysis with human MUC4, which has 24 documented isoforms, rat Muc4 likely exhibits similar alternative splicing patterns . Researchers should employ the following methodological approach:

  • RNA-Seq Analysis: Next-generation sequencing provides comprehensive identification of splice junctions. Target-enriched RNA-Seq focusing on the Muc4 locus increases sensitivity for detecting rare variants. Analysis should focus particularly on exon-exon junctions outside the tandem repeat region where most splice events occur .

  • RT-PCR Validation: Primers spanning predicted splice junctions can confirm variant existence. Nested PCR may be necessary for low-abundance variants.

  • Functional Classification: Following the human MUC4 paradigm, variants should be classified into functional families: secreted variants (lacking transmembrane domains), membrane-tethered variants (containing transmembrane domains), and variants lacking the tandem repeat domain .

The functional implications of these splice variants are significant. Secreted forms may act as decoy receptors or soluble signaling molecules, while membrane-tethered variants differ in their ability to interact with ERBB2 and activate downstream signaling . Variants lacking the tandem repeat domain may have altered protective functions on epithelial surfaces but maintained signaling capabilities. Expression patterns of these variants appear to be tissue-specific and disease-modulated, suggesting distinct biological roles that warrant further investigation .

What are the critical methodological considerations for studying Rat Mucin-4 interactions with ERBB2 signaling?

Studying the interactions between Rat Mucin-4 and ERBB2 requires careful experimental design due to the complexity of both proteins and their signaling pathways. Based on established research approaches, the following methodological considerations are critical:

  • Protein Domain Specificity: Focus experiments on the EGF-like domains in the Muc4β subunit, which are responsible for ERBB2 interaction. When designing recombinant constructs or selecting antibodies, ensure these domains remain structurally intact and accessible .

  • Cellular Context: Choose cellular models that reflect the physiological environment where these interactions occur. Polarized epithelial cells are preferred as Muc4 has been shown to segregate ERBB2 and other ERBB receptors in these cells . Primary rat epithelial cells or carefully selected rat cell lines maintain the species-specific interaction characteristics.

  • Phosphorylation Analysis: Since Muc4 induces specific phosphorylation of ERBB2, phospho-specific antibodies or phosphoproteomics approaches should be employed to detect these modifications. Western blotting with phospho-ERBB2 antibodies, followed by immunoprecipitation studies, can confirm direct interactions .

  • Downstream Signaling Assessment: Look beyond the direct Muc4-ERBB2 interaction to evaluate consequences on downstream pathways. This includes measuring activation of the ERK pathway, PI3K/Akt signaling, and other ERBB2 effectors using phospho-specific antibodies, reporter assays, or transcriptional profiling .

  • Functional Readouts: Include physiologically relevant endpoints such as proliferation, differentiation, migration, or apoptosis resistance to connect molecular interactions to cellular outcomes .

These methodological approaches will help ensure robust and physiologically relevant findings when investigating this important signaling axis.

What therapeutic potential does targeting Rat Mucin-4 have in disease models, and what are the experimental approaches to evaluate efficacy?

Targeting Rat Mucin-4 shows promising therapeutic potential in multiple disease models, particularly in nephrolithiasis and cancer. Based on current research, several experimental approaches can effectively evaluate the efficacy of Muc4-targeted interventions:

  • Nephrolithiasis Models: In ethylene glycol and ammonium chloride-induced CaOx nephrolithiasis rat models, silencing Muc4 effectively reduced oxalic acid and calcium contents in urine, decreased pathological biomarkers in serum, and inhibited calcium crystal formation in renal tubules . Efficacy evaluation should include:

    • Quantification of stone formation using microscopic analysis

    • Measurement of urinary and serum biochemical parameters

    • Assessment of oxidative stress markers and antioxidant enzyme levels

    • Histopathological examination of kidney tissues

  • Cancer Models: For evaluating Muc4-targeted therapies in cancer, approaches should include:

    • Tumor growth and metastasis assessment in xenograft models

    • Analysis of apoptotic markers (as Muc4's tumor-promoting properties appear related to apoptosis repression)

    • Evaluation of ERBB2 phosphorylation status and downstream signaling pathway activation

    • Investigation of cell-cell and cell-matrix adhesion properties affected by anti-Muc4 interventions

  • Therapeutic Strategies: Several approaches show promise:

    • Gene silencing technologies (siRNA, antisense oligonucleotides)

    • Domain-specific antibodies targeting the EGF-like domains

    • Small molecule inhibitors of the ERK signaling pathway as indirect Muc4 antagonists

    • Peptide mimetics that disrupt Muc4-ERBB2 interactions

For comprehensive efficacy evaluation, combining molecular, cellular, and physiological endpoints provides the most robust assessment of therapeutic potential. When designing preclinical studies, researchers should consider the translational implications, particularly how the high degree of structural conservation between rat and human MUC4 might facilitate development of therapies with cross-species applicability .

How do the structural and functional differences between Rat Mucin-4 and human MUC4 impact experimental design and translational research?

The structural and functional differences between Rat Mucin-4 and human MUC4 present important considerations for experimental design and translational research. Understanding these differences is crucial for proper interpretation of results and extrapolation to human conditions:

These considerations highlight the importance of targeted experimental approaches that focus on conserved functional elements when attempting to translate findings from rat models to human applications.

What evolutionary insights can be gained from studying Rat Mucin-4 in comparison to other species?

Studying Rat Mucin-4 in an evolutionary context provides valuable insights into mucin biology and functional adaptation. Comparative analysis across species reveals several important evolutionary patterns and mechanisms:

  • Domain Conservation and Divergence: The high degree of sequence similarity in different MUC4 orthologues suggests evolution from common ancestral domains. Sequence-based phylogenetic analysis indicates evolutionary closeness between human and dog MUC4, and between rat and mouse Muc4 . This domain-specific conservation pattern suggests selective pressure to maintain functional elements while allowing other regions to diversify.

  • Tandem Repeat Evolution: The remarkable variation in the central tandem repeat domain across species represents a fascinating example of evolutionary divergence. This variation likely resulted from replication slippage, unequal sister chromatid exchanges, and gene conversion during evolution . The maintenance of Ser and Thr codons corresponding to O-glycosylation sites despite sequence variation suggests functional conservation of the heavily glycosylated nature of this domain.

  • Functional Adaptation: All homologues of MUC4 contain a fully conserved putative GDPH proteolytic cleavage site, though the cleavage event has only been definitively demonstrated in rat Muc4 . This conservation across species underscores the functional importance of the two-subunit structure generated by this cleavage.

  • Splice Variant Diversity: The evolution of multiple splice variants (24 isoforms in humans) suggests adaptive advantages to maintaining protein diversity from a single gene . This evolutionary strategy allows tissue-specific and context-dependent expression of variants with distinct functional properties.

These evolutionary insights help researchers better understand which aspects of Muc4 biology are likely fundamental (conserved across species) versus those that may represent species-specific adaptations, guiding more targeted and translationally relevant experimental approaches.

How can crossreactivity between species be leveraged or avoided when selecting antibodies for Rat Mucin-4 research?

Crossreactivity between species presents both opportunities and challenges when selecting antibodies for Rat Mucin-4 research. Strategic approaches to this issue can significantly impact experimental success:

  • Leveraging Crossreactivity:

    • Target Conserved Domains: Antibodies directed against highly conserved regions such as the GDPH site or EGF-like domains in the β subunit offer cross-species reactivity. The 1G8 mouse monoclonal antibody exemplifies this advantage, detecting Mucin-4 protein from mouse, rat, and human origin across multiple applications including Western blotting, immunoprecipitation, immunofluorescence, and immunohistochemistry .

    • Multi-species Studies: Such antibodies enable direct comparisons between rat models and human samples without introducing the variable of different detection reagents.

    • Epitope Mapping: When selecting commercially available antibodies, those with documented epitope information from conserved regions provide greater confidence in cross-species applications.

  • Avoiding Unwanted Crossreactivity:

    • Target Variable Regions: For rat-specific detection, antibodies targeting the tandem repeat region, which shows significant interspecies variation, can provide species selectivity .

    • Validation Protocols: Comprehensive validation using positive controls (confirmed rat Muc4 expression) and negative controls (tissues or cells from Muc4 knockout models) ensures specificity.

    • Pre-absorption Controls: To eliminate cross-reactivity with related mucins, pre-absorption with recombinant proteins of potential cross-reactive mucins can improve specificity.

  • Practical Selection Criteria:

    • Application Compatibility: Different experimental techniques (Western blot, IHC, ELISA) may require different antibody characteristics. For example, antibodies recognizing linear epitopes work well in Western blots but may fail in applications requiring recognition of native conformation.

    • Monoclonal vs. Polyclonal: Monoclonal antibodies typically offer greater specificity and reproducibility, while polyclonal antibodies may provide higher sensitivity by recognizing multiple epitopes.

    • Validation Data Review: Carefully examine validation data provided by manufacturers, particularly any cross-reactivity testing with other mucin family members .

This strategic approach to antibody selection based on cross-reactivity considerations significantly enhances experimental reliability and interpretability in Rat Mucin-4 research.

What are the most significant open questions in Rat Mucin-4 research that warrant further investigation?

Despite considerable progress in understanding Rat Mucin-4, several significant questions remain unanswered, presenting valuable opportunities for further research. These knowledge gaps span molecular mechanisms, physiological functions, and therapeutic applications:

  • Splice Variant Functionality: While the existence of multiple splice variants has been established in human MUC4, the specific functions and expression patterns of rat Muc4 splice variants remain poorly characterized . Investigating the tissue-specific expression, subcellular localization, and distinct signaling properties of these variants would significantly advance our understanding of Muc4 biology.

  • Post-translational Regulation: The mechanisms controlling Muc4 proteolytic processing at the GDPH site, particularly the enzymes involved and the regulation of this cleavage under different physiological and pathological conditions, remain unclear . Additionally, the impact of glycosylation patterns on Muc4 function requires further investigation.

  • Signaling Integration: How Muc4-ERBB2 signaling integrates with other pathways, particularly in the context of oxidative stress and inflammation, represents an important area for further study . The bidirectional relationship between ERK pathway activation and Muc4 expression also warrants deeper investigation.

  • Therapeutic Targeting Specificity: Developing approaches that can selectively target pathological Muc4 overexpression without disrupting its physiological functions remains challenging. Identifying domain-specific or context-specific targeting strategies could overcome this limitation.

  • Translational Relevance: Better defining the parallels and differences between rat models and human pathologies in terms of MUC4's role would enhance the translational value of preclinical studies, particularly in nephrolithiasis and cancer research .

Addressing these questions through rigorous experimental approaches will significantly advance both fundamental understanding of Muc4 biology and its potential applications in treating human disease.

How might emerging technologies advance our understanding of Rat Mucin-4 biology and applications?

Emerging technologies offer unprecedented opportunities to address longstanding challenges and explore new frontiers in Rat Mucin-4 research. These innovative approaches have the potential to revolutionize our understanding of Muc4 biology and accelerate therapeutic applications:

  • CRISPR-Cas9 Domain Editing: Beyond simple gene knockout, precise editing of specific domains within the Muc4 gene enables functional analysis of individual structural elements. This approach could elucidate the roles of the EGF-like domains, GDPH cleavage site, or specific regions within the large alpha subunit without eliminating the entire protein .

  • Single-Cell RNA Sequencing: This technology allows characterization of Muc4 splice variant expression at the single-cell level, revealing cell-type specific patterns and potential functions that are masked in bulk tissue analysis. This approach is particularly valuable for heterogeneous tissues where Muc4 may have distinct roles in different cell populations .

  • Cryo-Electron Microscopy: Advances in structural biology techniques may finally overcome the challenges of determining the three-dimensional structure of heavily glycosylated mucins like Muc4, providing unprecedented insights into structure-function relationships and protein-protein interactions.

  • Glycoproteomics: The application of mass spectrometry-based glycoproteomics to analyze Muc4 glycosylation patterns under different physiological and pathological conditions will enhance our understanding of how these modifications influence Muc4 function .

  • Organoid Models: Rat kidney, lung, or pancreatic organoids expressing native or modified Muc4 provide physiologically relevant systems for studying function in a three-dimensional context that better recapitulates in vivo conditions than traditional cell culture.

  • Nanobody and Aptamer Technologies: These smaller affinity reagents may access epitopes in the densely glycosylated regions of Muc4 that are inaccessible to conventional antibodies, opening new possibilities for both research tools and therapeutic targeting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.