Recombinant Rat Muscarinic acetylcholine receptor M2 (Chrm2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for precise delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference for your application.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. To prevent degradation, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
Chrm2; Chrm-2; Muscarinic acetylcholine receptor M2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-466
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates a variety of cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through G protein interaction. The primary transduction effect is adenylate cyclase inhibition. Signaling promotes phospholipase C activity, leading to the release of inositol trisphosphate (IP3), which subsequently triggers calcium ion release into the cytosol.
Gene References Into Functions
  1. Studies suggest that CHRM2 levels are reduced in Brodmann's area 24 of individuals with mood disorders, implying potentially lower signaling by that receptor in this cortical region. An increase in CHRM2 levels might be involved in the mechanisms of action of mood stabilizers and tricyclic antidepressants. PMID: 26475745
  2. Prolonged stimulation with autoantibodies against the M2 muscarinic receptor resulted in ventricular dilatation and gradual deterioration of cardiac function. PMID: 26086781
  3. In control subjects, the expression of alpha-SMA mRNA in detrusor muscle cells was 200 times higher than that in urothelial cells. PMID: 25681120
  4. This study demonstrated the impact of early life arsenic exposure on brain cholinergic receptors and acetylcholinesterase activity in rats. PMID: 24517892
  5. Hyperglycemia led to increased expression of M2-muscarinic receptors in cardiomyocytes. PMID: 22293779
  6. This study revealed the involvement of M2 cholinergic receptors in the intricate mechanisms of functional interactions between dopaminergic and cholinergic systems regulating yawning and genital grooming. PMID: 23041487
  7. The extensive distribution of M4 receptors in the cortex, compared to the more limited and localized distribution of M2 receptors, suggests a prominent modulatory role for M4 receptors. PMID: 20600670
  8. The muscarinic M(4) receptor is the functionally predominant subtype in the rat striatum. PMID: 21114972
  9. We observed a trend towards increased gene expression of muscarinic receptor subtypes from M2 to M3 following birth trauma. PMID: 20445960
  10. Bile acid-induced arrhythmia is mediated by muscarinic M2 receptors in neonatal rat cardiac tissue. PMID: 20300620
  11. Coexpression of GABA B2 receptors rescues cell surface expression and function of muscarinic M2 receptors at the plasma membrane. PMID: 20016095
  12. Dysfunction of inhibitory neuronal M2 muscarinic receptors in the airways provides protection against hyperreactivity, while in the ileum, it contributes to gastrointestinal dysmotility associated with streptozotocin-induced diabetes. PMID: 11906948
  13. Vitamin A deficiency promotes bronchial hyperreactivity in rats by altering muscarinic M(2) receptor function. PMID: 11943668
  14. In normal bladders, both M(2) and M(3) receptors can induce contraction. In denervated bladders, the M(2) and M(3) receptors interact in a facilitatory manner to mediate contraction. PMID: 12185001
  15. The presence of large, cholinergic C-bouton nerve terminals is associated with m2-like immunoreactivity in the postsynaptic membrane. PMID: 12717708
  16. These results indicate that activation of peripheral M2 receptors produces antinociception in vivo and inhibits nociceptor activity in vitro. PMID: 14715385
  17. Evidence suggests the presence of M(2)- and M(3)-mAChR, at both the mRNA and protein levels, in the rat myometrium, and estrogen induces an increase in myometrial responsiveness to mAChR agonists. PMID: 15062561
  18. A decrease in m2R was observed in the somato-dendritic field of the nucleus basalis magnocellularis. PMID: 15748786
  19. Spontaneous contractions in the neonatal rat bladder are enhanced by the activation of M2 and M3 receptors. PMID: 16709645
  20. M2-like muscarinic receptors couple to a PTX-insensitive G-protein and to an ATP-dependent pathway to enhance IKV. PMID: 16953191
  21. SET protein directly interacts with the third intracellular loop of the M2 muscarinic receptor and co-immunoprecipitates with the intact receptor expressed in cells. PMID: 17065150
  22. In the reticular thalamic nucleus, m2-immunolabeling was predominantly distributed in the distal dendrite region, where cholinergic afferent fibers tend to terminate, and in the peripheral region of somata. PMID: 17845913
  23. Our results indicate that only the M(2) subtype is present in the rat atria. PMID: 18443764
  24. The muscarinic receptors in the rat gastric mucosal segments were composed of M(1), M(2), and M(3) subtypes. PMID: 18938154

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

Choosing the Optimal Expression System for Recombinant CHRM2 Production

Question: How do I select between HEK-293 cells, E. coli, and cell-free systems for recombinant CHRM2 expression to ensure proper post-translational modifications and functional activity?

Answer:
Experimental Design Considerations

  • HEK-293 Cells (Mammalian):

    • Advantages: Native folding, proper glycosylation, and membrane integration critical for receptor function .

    • Purity: >90% purity via Bis-Tris PAGE, anti-tag ELISA, and SEC-HPLC .

    • Applications: Structural studies, ligand-binding assays requiring native conformation.

  • E. coli (Bacterial):

    • Advantages: High yield, cost-effective, ideal for large-scale production of cytoplasmic domains or peptide fragments .

    • Limitations: Lacks eukaryotic PTMs; may form inclusion bodies.

    • Purity: >97% for GST/His-tagged proteins .

  • Cell-Free Protein Synthesis (CFPS):

    • Advantages: Flexible for membrane protein production; avoids cellular toxicity.

    • Purity: 70–80% via SDS-PAGE and SEC-HPLC .

Data-Driven Decision Table

SystemGlycosylationMembrane IntegrationYieldCostBest Use Case
HEK-293 Cells✔️✔️ModerateHighFunctional/Structural Studies
E. coliHighLowPeptide/Domain Production
CFPSModerateModerateRapid Screening

Troubleshooting: For HEK-293 systems, optimize transfection reagents (e.g., PEI) and growth media to maximize yield .

Optimizing M2 Receptor Activation Protocols for Functional Studies

Question: How do I design experiments to study M2 receptor activation in primary cells or differentiated adipose-derived stem cells (dASCs), considering agonist specificity and off-target effects?

Answer:
Methodological Approach

  • Agonist Selection:

    • Arecaidine propargyl ester (APE): M2-preferred agonist; induces reversible cell cycle arrest in dASCs by downregulating proliferation markers (e.g., c-Jun) and upregulating differentiation markers (e.g., Egr-2) .

    • Carbamylcholine (Cch): Broad muscarinic agonist; synergizes with EGF or FBS to enhance proliferation in airway smooth muscle cells (ASMCs) but inhibits TNF-α-induced growth .

  • Experimental Controls:

    • Antagonists:

      • AF-DX-116: M2-specific antagonist; blocks Cch-mediated proliferation in ASMCs .

      • 4-DAMP: M3-specific antagonist; less effective in ASMCs, confirming M2 dominance .

Data Interpretation Challenges
Conflicting outcomes (e.g., growth arrest vs. proliferation) may arise from:

  • Cell-Type Specificity: M2 activation inhibits dASC growth but promotes ASMC proliferation .

  • Microenvironment: Synergistic growth factors (e.g., EGF) or inflammatory mediators (e.g., TNF-α) modulate receptor responses .

Troubleshooting: Validate receptor expression via Western blot (e.g., CHRM2 antibody PA1325-1, 71 kDa band) and confirm agonist/antagonist specificity with dose-response curves.

Validating Antibody Specificity for CHRM2 in Cross-Species IHC

Question: How do I test the cross-reactivity of anti-CHRM2 antibodies (e.g., PA1325-1) for zebrafish brain IHC, given limited validation data?

Answer:
Methodological Workflow

  • Sequence Homology Analysis:

    • BLAST Alignment: Compare immunogen sequence (e.g., human CHRM2) with zebrafish CHRM2. High homology (>80%) suggests potential cross-reactivity .

  • Pilot Testing:

    • Sample Prep: Optimize fixation (e.g., paraformaldehyde) and permeabilization (e.g., 0.1% Triton X-100).

    • Antibody Titration: Start at 1:500 dilution; adjust based on background signal.

  • Controls:

    • Negative Control: Omit primary antibody.

    • Positive Control: Use rat brain tissue (validated for PA1325-1) .

Expected Outcomes

SpeciesExpected SignalValidated Use Cases
HumanStrongWB, IHC
MouseModerateWB, IHC
RatStrongWB, IHC
ZebrafishUnknownPilot testing required

Troubleshooting: High background may indicate non-specific binding; use blocking buffers (e.g., 5% BSA) or pre-absorption with peptide immunogen.

Analyzing Conflicting Data on M2 Receptor Effects in Proliferation vs. Differentiation

Question: Why do M2 receptor agonists induce growth arrest in dASCs but promote proliferation in ASMCs ? How do I reconcile these findings?

Answer:
Mechanistic Insights

  • Cell-Specific Signaling Pathways:

    • dASCs: M2 activation downregulates c-Jun and upregulates Egr-2, favoring differentiation over proliferation .

    • ASMCs: M2 activation synergizes with growth factors (e.g., EGF) via distinct signaling (e.g., PI3K/Akt) .

  • Environmental Context:

    FactordASCs ASMCs
    Growth FactorsAbsentPresent (EGF, FBS)
    Inflammatory CuesAbsentPresent (TNF-α)
    OutcomeGrowth ArrestProliferation

Experimental Design Recommendations

  • Isolate Variables: Test receptor activation in serum-free vs. serum-rich media.

  • Biomarker Profiling: Quantify c-Jun, Egr-2 (differentiation) and ERK, Akt (proliferation) via qPCR or phospho-specific antibodies.

Functional Assays for Assessing Recombinant CHRM2 Activity

Question: What functional assays are most effective for validating recombinant CHRM2 activity in vitro?

Answer:
Assay Selection and Optimization

  • Ligand-Binding Assays:

    • [³H]-Acetylcholine Binding: Quantify receptor affinity (Kd).

    • Fluorescence-Based Assays: Use fluorescently labeled agonists (e.g., Alexa Fluor-conjugated ACh).

  • Signaling Pathway Activation:

    • G Protein-Coupled Response: Measure intracellular cAMP levels (e.g., via ELISA) inhibited by M2 activation.

    • Ion Channel Modulation: Patch-clamp recordings to assess potassium channel activity.

  • Cellular Functional Assays:

    • Proliferation (MTS-PMS): Assess growth in ASMCs .

    • Migration (Scratch Assay): Evaluate inhibition in dASCs .

Troubleshooting: For low signal, ensure proper receptor membrane integration (validate via confocal imaging with CHRM2 antibodies) .

Structural Insights for CHRM2-Ligand Interactions

Question: How can I leverage recombinant CHRM2 for structural studies to map binding sites of muscarinic agonists/antagonists?

Answer:
Methodological Approach

  • Cryo-EM or X-Ray Crystallography:

    • Purification: Use His-tagged CHRM2 from HEK-293 cells (purity >90%) .

    • Stabilization: Co-express with nanobodies or fusion partners (e.g., maltose-binding protein).

  • Mutagenesis and Binding Studies:

    • Site-Directed Mutagenesis: Target conserved residues in the orthosteric binding pocket (e.g., Asp147, Tyr148).

    • Competitive Binding Assays: Measure displacement of radiolabeled ligands by mutants.

  • Computational Modeling:

    • Docking Studies: Predict agonist/antagonist poses using crystal structures of related muscarinic receptors.

Challenges: Low-resolution structures may obscure side-chain interactions; validate with mutagenesis data.

Therapeutic Target Validation for CHRM2 in Neurological/Respiratory Diseases

Question: How can I validate CHRM2 as a therapeutic target in vivo using recombinant systems?

Answer:
Preclinical Validation Strategies

  • In Vitro Models:

    • Neuroregeneration: Test CHRM2 agonists in dASC differentiation assays .

    • Airway Hyperresponsiveness: Assess ASMC proliferation modulation by CHRM2 antagonists .

  • In Vivo Models:

    • Nerve Injury: Overexpress CHRM2 in Schwann cells to enhance remyelination.

    • Asthma: Administer M2 antagonists (e.g., AF-DX-116) in ovalbumin-challenged rats.

  • Biomarker Development:

    • CHRM2 Expression: Quantify receptor levels in patient biopsies via IHC (PA1325-1 antibody) .

Data Analysis: Use multivariate models to correlate CHRM2 expression with disease severity.

Addressing Heterogeneity in Recombinant CHRM2 Preparations

Question: How do I ensure batch consistency in recombinant CHRM2 for longitudinal studies?

Answer:
Quality Control Protocols

  • Purity Assessment:

    • SDS-PAGE + Coomassie Staining: Verify ~45–71 kDa bands (depending on tags) .

    • SEC-HPLC: Confirm monomeric state (e.g., elution at ~150–200 kDa) .

  • Functional Testing:

    • Ligand Binding: Normalize activity across batches using EC50 values for APE or Cch.

    • Cellular Assays: Standardize proliferation/differentiation responses in dASCs or ASMCs.

  • Storage Optimization:

    • Lyophilized Form: Reconstitute with stabilizing agents (e.g., glycerol, BSA) to prevent aggregation.

Troubleshooting: Lot-to-lot variability may require re-optimizing protocols; use orthogonal methods (e.g., NMR) for structural validation.

Cross-Talk Between CHRM2 and Other Muscarinic Receptors

Question: How do I differentiate CHRM2-specific effects from pan-muscarinic responses in complex biological systems?

Answer:
Experimental Strategies

  • Receptor Knockout/Knockdown:

    • CRISPR-Cas9: Generate CHRM2-KO cells; compare responses to agonists/antagonists.

    • siRNA: Validate knockdown efficiency via qPCR or Western blot .

  • Antagonist Combinations:

    • M2-Selective: AF-DX-116 (blocks CHRM2) .

    • M3-Selective: 4-DAMP (controls for off-target effects) .

  • BRET/FRET Assays:

    • G Protein Coupling: Monitor β-arrestin recruitment specific to CHRM2.

Data Interpretation: Use hierarchical clustering to identify CHRM2-dependent pathways vs. shared muscarinic signals.

Leveraging CHRM2 for Drug Discovery in CNS Disorders

Question: What high-throughput screening (HTS) platforms are suitable for identifying CHRM2 modulators?

Answer:
HTS Strategies

  • Cell-Based Assays:

    • Fluorometric Imaging Plate Reader (FLIPR): Measure intracellular calcium mobilization (indirect readout of Gq/11 coupling).

    • Beta-Lactamase Reporter Gene Assays: Track cAMP levels inhibited by CHRM2 activation.

  • Biophysical Assays:

    • Thermal Shift Assays (TSA): Screen for ligands stabilizing CHRM2.

    • Surface Plasmon Resonance (SPR): Measure real-time binding kinetics.

  • Virtual Screening:

    • Docking: Use CHRM2 homology models to predict ligand binding.

    • Ensemble Docking: Account for receptor flexibility.

Challenges: HTS may miss allosteric modulators; combine with orthogonal assays (e.g., radioligand binding).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.