Recombinant Rat Muscarinic acetylcholine receptor M3 (Chrm3)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Chrm3 belongs to the muscarinic acetylcholine receptor family (M1–M5) and is encoded by the Chrm3 gene (UniProt ID: P08483). Key features include:

PropertyDetails
Gene ID24260 (Rat)
Protein Length589 amino acids (rat isoform)
Structural Domains7 transmembrane helices, extracellular N-terminus, intracellular C-terminus
Signaling PathwayGq/11-coupled; activates phospholipase C (PLC), increasing intracellular calcium
Tissue DistributionSmooth muscle (e.g., bladder, airways), endocrine/exocrine glands, brain

Production and Purification

Recombinant Chrm3 is generated using multiple expression systems, each offering distinct advantages:

Expression Systems Comparison

HostPurityYieldTagApplications
E. coli≥85%0.02–1 mgN/C-terminal (varies)Binding assays, structural studies
Baculovirus≥85%0.02–1 mgN-terminal HisFunctional studies, crystallography
Mammalian Cells≥85%0.02 mgUndisclosedCell-based signaling assays

Storage: Lyophilized or liquid formats at -20°C/-80°C; stable for 6–12 months .

Functional and Phenotypic Findings

Studies using recombinant Chrm3 and knockout models have elucidated its roles:

Key Functional Roles

  • Smooth Muscle Contraction: Mediates detrusor muscle activation in the bladder; Chrm3⁻/⁻ mice exhibit urinary retention (males > females) .

  • Secretory Regulation: Essential for salivary and pancreatic secretions .

  • Immune Modulation: Upregulates NF-κB p65, IFN-γ, and IL-17A in human memory T helper cells, promoting pro-inflammatory responses .

Disease Associations

ConditionMechanismReference
Prune Belly SyndromeCHRM3 mutations impair bladder smooth muscle
Type 2 DiabetesM3R blockade (e.g., antipsychotics) disrupts insulin secretion
Neurogenic InflammationChrm3-driven NF-κB activation enhances cytokine release

Immunological and Biochemical Tools

Reagents developed for Chrm3 research include:

Antibodies

  • bs-1289R (Bioss): Rabbit polyclonal antibody targeting residues 481–589; validated for WB, IHC, and IF .

  • ab139964 (Abcam): Rat-specific peptide antigen for antibody generation .

Assay Kits

  • H00001131-Q01 (Bio-Techne): GST-tagged recombinant protein (1–67 aa) for ELISA and affinity purification .

Research Applications

Recombinant Chrm3 is pivotal for:

  1. Drug Discovery: Screening M3-selective agonists/antagonists for overactive bladder or dry mouth therapies .

  2. Pathway Analysis: Mapping Gq/11-mediated signaling in smooth muscle and immune cells .

  3. Structural Biology: Resolving ligand-receptor interactions to design subtype-specific drugs .

Challenges and Considerations

  • Post-Translational Modifications: Glycosylation and phosphorylation patterns vary by expression system, affecting functional studies .

  • Species Specificity: Rat Chrm3 shares 94% amino acid identity with human CHRM3 but may exhibit pharmacological differences .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
Chrm3; Chrm-3; Muscarinic acetylcholine receptor M3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVTQLGSYNISQETGNFSSNDTSSDPLG GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGVK RSSRRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET RAIYSIVLKLPGHSSILNSTKLPSSDNLQVSNEDLGTVDVERNAHKLQAQKSMGDGDNCQ KDFTKLPIQLESAVDTGKTSDTNSSADKTTATLPLSFKEATLAKRFALKTRSQITKRKRM SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP VCYALCNKTFRTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is Pi turnover.
Gene References Into Functions
  1. Research suggests that, in atrial myocardium (or isolated cardiomyocytes), activation of muscarinic receptors M3 (Chrm3) leads to shortening of action potentials via suppression of L-type calcium channels. While the major potassium channels are not affected, inwardly rectifying potassium channels are suppressed. PMID: 27858307
  2. M1 and M3 muscarinic receptors may contribute to the neurotoxicity of anhydroecgonine methyl ester, a cocaine pyrolysis product. PMID: 26626425
  3. Our findings suggest that the mechanism underlying deficits in learning and memory in rats with chronic fluorosis may be related to the decreased expressions of M1 and M3 in mAChRs PMID: 25417050
  4. The expression of beta3-adrenoceptor and muscarinic type 3 receptor immuno-reactivity in the major pelvic ganglion of the rat has been investigated. PMID: 25920933
  5. The ventricular myocardium of rat pups differs from that of mature rats by exhibiting a much greater sensitivity to selective stimulation of M3 receptors, suggesting an important functional role of M3 receptors in newborn rats, which declines with age. PMID: 26033578
  6. Neonatal hypoglycemia decreased total muscarinic receptors (p < 0.001) with reduced muscarinic M1, M2, and M3 receptor genes (p < 0.001) in one-month-old rats. PMID: 25474381
  7. Expressions of M2R and M3R mRNA were increased in urothelial cells and decreased in detrusor muscles following chronic cystitis. PMID: 25681120
  8. Activation of muscarinic receptors leads to rapid activation of several kinases that regulate contraction of the longitudinal muscle of the colon. PMID: 25891767
  9. The relative mRNA expression of M3 and M5 mAChR in bones of a rat osteoporosis model was investigated. PMID: 24866457
  10. The upregulation of M-mAChR during myocardial hypertrophy could potentially relieve the hypertrophic response provoked by angiotensin II. PMID: 24028210
  11. Muscarinic M3 receptors are downregulated in the brain stem following spinal cord injury. PMID: 23184186
  12. These results indicate a complex antagonistic interplay between G(q)-activated PKC and Gbetagamma in the regulation of L-VDCC, involving multiple cytosolic segments of alpha(1C). PMID: 22990911
  13. Muscarinic receptor expression is developmentally regulated; M1, M3, and M4 receptors are the primary subtypes expressed in oligodendrocyte progenitor cells. PMID: 21913336
  14. Data suggest that Chrm3 is up-regulated in cell membranes of parotid glands in a model of periodontitis and participates in potassium release. Chrm3 expression appears to return to control levels upon indomethacin treatment of periodontitis. PMID: 22513211
  15. The M3 subtype of muscarinic acetylcholine receptor promotes cardioprotection through the suppression of miR-376b-5p PMID: 22396777
  16. Taurine supplementation of low-protein diet rats restored Ach-M3R, Synt1, SNAP-25 protein levels and increased sarcoendoplasmatic reticulum Ca2+-ATPase (SERCA) 3 protein expression in rats on a low-protein diet. PMID: 21543213
  17. NGF expression increased, but M3 subtype muscarinic receptor expression decreased in the seminal vesicle of diabetic rats. PMID: 22141271
  18. Activation of M3R dimers requires a conformational change of the N-terminal segment of the i3 loop PMID: 22031716
  19. The structure of the G(q/11)-coupled M3 mAChR ('M3 receptor', from rat) bound to the bronchodilator drug tiotropium and identify the binding mode for this clinically important drug PMID: 22358844
  20. Our findings suggest an interaction between vitamin D(3) and muscarinic M3 receptors in regulating insulin secretion from the pancreas. PMID: 20655720
  21. Expression of muscarinic receptor M1, M3, M5 subunits decreased in the flocculus after unilateral labyrinthectomy. PMID: 19160866
  22. The study indicated that M and M receptors, IP3 and cGMP were functionally regulated during diabetes as a function of age PMID: 21054404
  23. Chrm3 receptor is located on presynaptic glutamatergic terminals afferent to the recorded pyramidal neuron, thus decreasing glutamate release. PMID: 20600670
  24. Muscarinic M(1) receptor showed a significant decrease and muscarinic M(3) receptor subtype showed a significant increased binding in the cerebral cortex of hypoglycemic rats compared to diabetic and control rats PMID: 21126518
  25. We observed a tendency in the gene expression of muscarinic receptor subtypes from M2 toward M3 after birth trauma. PMID: 20445960
  26. NF-kappaB signaling plays a critical role in controlling the expression of the muscarinic M(3) receptor. PMID: 20541544
  27. Acetylcholine, through muscarinic M1 and M3 receptors, stimulated calcium release from the pancreatic islets. PMID: 19554469
  28. Increased beta-catenin activity is associated with M(3) mAChR's binding during myocardial infarction. PMID: 19473345
  29. Results indicate that long-term low dose somatotropin and insulin treatment regulates muscarinic M1 and M3 cholinergic and NMAR1 and mGluR5 glutamate receptor subtypes in aging rats and rejuvenates brain function. PMID: 19666081
  30. An in situ disulfide cross-linking strategy reveals the structure of the inactive and active state of the M3 muscarinic receptor by identifying residues in transmembrane (TM) I close to Cys532, a residue present in the central portion of TM VII. PMID: 12056896
  31. In normal bladders, both M(2) and M(3) receptors can induce contraction. In the denervated bladder, the M(2) and the M(3) receptors interact in a facilitatory manner to mediate contraction. PMID: 12185001
  32. The m1-m5 muscarinic subtypes have been mapped to the following chromosomes: Chrm1, chromosome 1; Chrm2, chromosome 4; Chrm3, chromosome 17; Chrm4, chromosome 3; and Chrm5, chromosome 3. PMID: 12433399
  33. The presence of M3-like receptors on mesencephalic GABAergic neurones was confirmed. PMID: 14766941
  34. Evidence supports the presence of M(2)- and M(3)-mAChR, at the mRNA and protein level, in the rat myometrium, and estrogen induces an increase in myometrial responsiveness to mAChR agonists. PMID: 15062561
  35. A functional balance of central muscarinic M1 and M3 receptor subtypes is suggested to regulate sympathetic and parasympathetic activity, which in turn control islet cell proliferation and glucose homeostasis. PMID: 15350825
  36. Data suggest a conformational link between the highly conserved Asp-113, Arg-165, and Tyr-250 residues that are critical for receptor activation. PMID: 15572356
  37. Agonist activation of the M(3) muscarinic acetylcholine receptor results in pronounced conformational changes. PMID: 15870064
  38. A conformational change occurs adjacent to the ligand-binding pocket of the M(3) muscarinic acetylcholine receptor after agonist binding. PMID: 16093246
  39. Spontaneous contractions in the neonatal rat bladder are enhanced by activation of M2 and M3 receptors. PMID: 16709645
  40. Interaction of the third intracellular loop of SET protein with M3 muscarinic receptor (M3-MR) leads to reduced M3-MR signaling capacity. PMID: 17065150
  41. We conclude that previously reported differences relate to the use of inhibitors rather than experimental protocols and that the overall data do not support a role for PLC in M(3) muscarinic receptor-mediated rat bladder contraction. PMID: 17596535
  42. In the reticular thalamic nucleus, m3-immunolabeling was distributed in a large part of somata and in proximal dendrite shafts rather than in the distal dendrite region. PMID: 17845913
  43. Generation of an agonistic binding site for blockers of the M(3) muscarinic acetylcholine receptor. PMID: 18237275
  44. In the inflamed bladder, NO seems to be released via cholinergic stimuli through mucosal muscarinic M3/M5 receptors, presumably on urothelial cells, affecting bladder function. PMID: 18246091
  45. The muscarinic receptors in the rat gastric mucosal segments were composed of M(1), M(2) and M(3) subtypes. PMID: 18938154
  46. Taken together, these results suggest that the muscarinic M3 receptor is involved in the regulation of glucose uptake and/or lipolysis in adipose tissue. PMID: 19111904
  47. Stimulation of the presinaptic M1-muscarinic receptors of the bladder cholinergic nerve terminals and M3-muscarinic receptors located on the bladder detrusor muscle induce the release of urinary bladder-derived relaxant factor. PMID: 19416629
  48. Results demonstrate that activation of muscarinic receptors exerts diverse effects on GABAergic transmission in the entorhinal cortex. PMID: 19494196
  49. The muscarinic receptors present in undifferentiated Fisher-rat thyroid epithelial cells belong to the M(3) subtype. Their binding affinities for various antagonists were determined. PMID: 19627722
  50. Increased PKC-epsilon activity is associated with M3-mAChR during myocardial ischemia. PMID: 19685039

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Muscarinic Acetylcholine Receptor M3 and what cellular responses does it mediate?

The muscarinic acetylcholine receptor M3 (Chrm3) is one of five subtypes of muscarinic receptors (M1-M5) belonging to the G protein-coupled receptor family with seven transmembrane domains. It primarily mediates various cellular responses through coupling with Gq/11 proteins, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels. The primary transducing effect of Chrm3 is phosphoinositide (Pi) turnover, which distinguishes it from other muscarinic receptor subtypes that might primarily inhibit adenylate cyclase (M2 and M4 subtypes) . Unlike M2 and M4 receptors that couple to Gi/o proteins, M3 receptors (like M1 and M5) typically couple to Gq/11 proteins that activate phospholipase C .

What are the critical physiological functions of Chrm3 identified through knockout models?

Studies using Chrm3 knockout mice have revealed several key physiological functions of this receptor subtype. Chrm3 plays essential roles in salivary secretion, pupillary constriction, and bladder detrusor contractions . Interestingly, researchers have observed a significant sex difference in micturition mechanisms, with prominent urinary retention observed only in male knockout mice . Despite these critical autonomic functions, Chrm3-mediated signals in digestive and reproductive organs appear to be dispensable, likely due to redundant mechanisms through other muscarinic receptor subtypes or alternative mediators. Knockout mice maintain reproductive abilities, indicating that Chrm3 is not essential for reproductive function . Recent research has also identified Chrm3 localization to primary endothelial cilia with involvement in nitric oxide regulation, cognitive processes, and vascular function .

How is Chrm3 gene expression typically measured in experimental settings?

Chrm3 gene expression can be measured using several molecular biology techniques, with Northern blot analysis being a classic method. In this approach, total RNA is extracted from tissues (e.g., brain) and hybridized with specifically designed probes corresponding to parts of the coding regions of Chrm3 . PCR-based methods are also employed, particularly for verification of gene targeting in knockout models. For instance, researchers have used PCR screening to verify endothelial-specific recombination of the Chrm3 gene using specific primers to amplify distinctive fragments . For protein-level detection, Western blot analysis can assess CHRM3 expression across different tissues, as demonstrated in studies comparing expression in aorta, heart, brain, and liver of control versus knockout mice . Immunofluorescence techniques, particularly en-face staining of tissue sections, have been valuable for localizing CHRM3 to specific subcellular structures such as primary cilia in endothelial cells .

How are recombinant Chrm3 targeting vectors designed for gene knockout studies?

The design of targeting vectors for Chrm3 knockout studies requires careful strategic planning. A typical approach involves replacing a critical portion of the Chrm3 gene (including the translation initiation codon) with a selection cassette. For example, researchers have constructed targeting vectors by deleting a specific fragment (e.g., a 1.5-kb fragment including the translation initiation codon) of the mouse Chrm3 gene and replacing it with a phosphoglycerate kinase I promoter-neo-bpA cassette . Homology arms flanking the targeted region facilitate homologous recombination in embryonic stem (ES) cells. A typical design includes upstream (e.g., 1.0 kb) and downstream (e.g., 9.0 kb) fragments placed around the selection cassette . Additionally, a negative selection marker such as a PGK-DTA (phosphoglycerate kinase I promoter-diphtheria toxin A) cassette is often included at the upstream end in reverse orientation to reduce random integration events . For conditional knockout strategies, loxP sites are positioned to flank the critical region, enabling tissue-specific deletion when combined with appropriate Cre recombinase-expressing mouse lines.

What screening methods are used to identify successful Chrm3 genetic modifications?

Several complementary screening methods are employed to identify and verify successful Chrm3 genetic modifications:

These complementary approaches provide robust verification of genetic modifications at DNA, RNA, and protein levels, essential for establishing valid knockout models.

What controls should be included in functional studies of Chrm3?

Comprehensive functional studies of Chrm3 require several types of controls to ensure valid and interpretable results:

  • Genetic controls:

    • Wild-type littermates serve as baseline controls for comparison

    • Heterozygous animals help assess gene dosage effects

    • For conditional knockout studies, mice carrying the floxed allele without Cre expression are critical controls

    • Age-matched and sex-matched controls are essential given the observed sex differences in some Chrm3-mediated functions

  • Molecular verification controls:

    • Northern blot analysis comparing Chrm3 expression across genotypes, with glyceraldehyde-3-phosphate dehydrogenase gene (Gapd) as a loading control

    • Expression analysis of other muscarinic receptor subtypes (e.g., Chrm1) to confirm their expression remains unchanged, ruling out compensatory upregulation

  • Tissue-specific considerations:

    • When studying tissue-specific knockouts, analysis of multiple tissues (targeted and non-targeted) confirms the specificity of the genetic modification

    • For endothelial-specific knockouts, comparing expression in vascular tissues (aorta) versus other organs (heart, brain, liver) verifies targeting specificity

  • Behavioral and physiological controls:

    • Multiple age groups should be tested when studying age-dependent effects (e.g., 3-6 months versus 9-12 months for cognitive studies)

    • Comparison with disease models (e.g., Alzheimer's disease models) provides context for phenotypic interpretations

    • Time-course measurements during behavioral tests (e.g., all 30 tones of fear extinction) rather than single timepoints provides comprehensive functional assessment

These controls ensure that observed phenotypes are specifically attributable to Chrm3 manipulation rather than to confounding factors or technical artifacts.

How has the localization of Chrm3 to primary cilia in endothelial cells advanced our understanding of its function?

The discovery of CHRM3 localization to primary endothelial cilia represents a significant advancement in understanding the receptor's function. En-face immunofluorescence staining of artery sections has demonstrated that CHRM3 is specifically localized to primary endothelial cilia, with this localization absent in endothelial-specific Chrm3 knockout mice (VECre:Chrm3) . This specialized localization appears critical for nitric oxide (NO) regulation in vascular endothelium, linking Chrm3 function to vascular tone and endothelial health . The finding has established a novel connection between primary cilia, cholinergic signaling, and vascular function.

Furthermore, studies with endothelial-specific Chrm3 knockout mice have revealed that this ciliary localization may influence cognitive functions. Fear extinction learning is altered in these knockout models, suggesting an unexpected connection between vascular endothelial Chrm3 in primary cilia and neural processes . This discovery bridges traditionally separate research domains—vascular biology and neuroscience—suggesting that endothelial cholinergic signaling through ciliary Chrm3 may influence brain function, possibly through NO-mediated mechanisms . This finding opens new avenues for investigating neurovascular coupling and the role of vascular function in cognitive health and neurodegenerative disorders.

What challenges exist in studying and interpreting Chrm3 function across different tissues?

Several significant challenges complicate the study and interpretation of Chrm3 function across tissues:

  • Receptor redundancy and compensation: The five muscarinic receptor subtypes show overlapping expression in many tissues, and functional redundancy can mask phenotypes in single-subtype knockout models. This is evidenced by the preserved reproductive abilities in Chrm3 knockout mice, suggesting compensatory mechanisms through other subtypes or alternative mediators .

  • Sex-specific differences: Prominent urinary retention was observed only in male Chrm3 knockout mice, indicating significant sex differences in the micturition mechanism . These sex-dependent effects necessitate studying both sexes and complicate the generalization of findings.

  • Age-dependent effects: Studies examining fear extinction in different age groups (3-6 months versus 9-12 months) revealed age-dependent differences in cognitive phenotypes associated with endothelial Chrm3 deletion . This temporal dimension adds complexity to experimental design and interpretation.

  • Tissue-specific localization: The specialized localization of CHRM3 to primary cilia in endothelial cells represents a technical challenge for detection and functional assessment . Preserving these delicate structures during tissue preparation requires specialized techniques such as en-face preparation of arterial sections.

  • Integration of diverse functional readouts: Chrm3 functions span multiple physiological systems, requiring diverse experimental approaches—from behavioral testing to molecular signaling analysis. Integrating these diverse data types to form coherent mechanistic models represents a significant challenge.

These challenges necessitate comprehensive experimental approaches using multiple methodologies, careful controls, and consideration of contextual factors like sex, age, and tissue-specific characteristics when interpreting Chrm3 function.

How do Chrm3 knockout models contribute to understanding cognitive processes and potential therapeutic applications?

Chrm3 knockout models have provided unexpected insights into cognitive processes, particularly through studies of endothelial-specific deletion. Research examining fear conditioning and extinction has revealed intriguing effects of Chrm3 deletion on cognitive functions:

  • Altered fear extinction patterns: Endothelial-specific Chrm3 knockout mice (VECre:Chrm3) show distinctive patterns of fear extinction learning compared to controls. In younger mice (3-6 months), these knockouts display higher freezing at earlier timepoints during extinction, indicating altered learning dynamics .

  • Age-dependent effects: Different patterns emerge between 3-6 month and 9-12 month age groups, suggesting age-dependent roles of endothelial Chrm3 in cognitive processes . This age-dependency may reflect interactions with age-related changes in vascular function or neuronal plasticity.

  • Comparison with disease models: Studies comparing Chrm3 knockout mice with Alzheimer's disease model mice (3xTgAD) provide valuable insights into potential therapeutic mechanisms. Alzheimer's model mice show the worst fear extinction performance, with a nearly flat learning curve, while endothelial Chrm3 knockout mice show intermediate phenotypes .

  • Vascular-cognitive connection: The influence of endothelial Chrm3 (specifically in primary cilia) on cognitive functions suggests a vascular component to cognitive processes. Nitric oxide regulation, linked to endothelial Chrm3, may mediate between vascular function and cognitive performance .

These findings open potential therapeutic avenues targeting endothelial Chrm3 for cognitive disorders, particularly those with vascular components like vascular dementia or Alzheimer's disease. They highlight the importance of vascular health in cognitive function and suggest that modulating cholinergic signaling in endothelial cells could influence cognitive outcomes in age-related neurological conditions.

What statistical approaches are recommended for analyzing behavioral data from Chrm3 studies?

Analyzing behavioral data from Chrm3 studies, particularly those involving cognitive functions like fear extinction, requires sophisticated statistical approaches:

These statistical approaches should be combined with appropriate sample sizes determined through power analysis, blinded assessment of outcomes when possible, and transparent reporting of all data exclusions and statistical methods.

How can researchers address contradictory findings in Chrm3 literature?

Addressing contradictory findings in Chrm3 research literature requires systematic approaches:

  • Methodological evaluation: Carefully examine experimental differences including:

    • Animal models: Species, strain, age, sex, genetic background

    • Knockout strategies: Conventional versus conditional, targeting approach

    • Tissue preparation methods: Fixation protocols, section techniques

    • Assay conditions: In vitro versus in vivo, environmental factors

  • Contextual considerations: Assess biological contexts that might explain differences:

    • Age-dependent effects: As demonstrated in fear extinction studies with different age groups

    • Sex differences: As observed in bladder function studies showing male-specific urinary retention

    • Tissue-specific compensatory mechanisms: Redundancy through other muscarinic receptor subtypes

  • Direct comparative studies: When possible, design experiments that directly test competing hypotheses under identical conditions. Include both positive and negative controls relevant to contradictory findings.

  • Integrated analytical frameworks:

    • Systematic reviews summarizing methodological differences across studies

    • Meta-analyses where sufficient comparable studies exist

    • Triangulation of evidence using multiple complementary methods

  • Collaborative approaches: Establish collaborations between laboratories reporting contradictory results to standardize methodologies and jointly investigate discrepancies.

By systematically addressing methodological, contextual, and analytical aspects of contradictory findings, researchers can work toward a more cohesive understanding of Chrm3 function across different biological systems and experimental paradigms.

What are promising new methodologies for studying Chrm3 function in complex physiological systems?

Several innovative methodologies show promise for advancing Chrm3 research in complex physiological systems:

  • Advanced genetic approaches:

    • Cell type-specific and temporally controlled Cre-loxP systems for precise targeting of Chrm3 in specific populations (as demonstrated with endothelial-specific deletion)

    • CRISPR-Cas9 genome editing for generating subtle mutations or tagged versions of Chrm3 at endogenous loci

    • Single-cell transcriptomics to identify cell populations expressing Chrm3 and characterize their molecular signatures

  • High-resolution imaging techniques:

    • Super-resolution microscopy (STED, STORM, PALM) for nanoscale localization of Chrm3 in subcellular compartments

    • Expansion microscopy to physically enlarge specimens for enhanced visualization of structures like primary cilia

    • Live-cell imaging using fluorescent biosensors to monitor Chrm3 activation and signaling in real-time

  • Functional assessment tools:

    • Optogenetic or chemogenetic approaches to selectively activate or inhibit cells expressing Chrm3

    • Multiphoton imaging for deep tissue visualization of Chrm3-expressing cells in intact organs

    • Fiber photometry for monitoring activity in Chrm3-expressing neurons during behavior

  • Translational approaches:

    • Human induced pluripotent stem cell (iPSC)-derived models expressing fluorescently tagged Chrm3

    • Organoid systems to study Chrm3 function in miniaturized human tissue contexts

    • Non-invasive imaging of Chrm3 expression or activity using PET ligands or functional MRI

  • Computational integration:

    • Systems biology approaches to model Chrm3 signaling networks

    • Machine learning for analyzing complex behavioral phenotypes in Chrm3 mutant animals

    • Multi-omics integration to correlate Chrm3 expression with functional outcomes across tissues

These advanced methodologies will enable more precise dissection of Chrm3 function across different physiological systems, potentially revealing new roles and therapeutic applications.

What key knowledge gaps remain in understanding Chrm3 function across different physiological systems?

Despite significant advances, several important knowledge gaps remain in understanding Chrm3 function:

  • Subcellular localization mechanisms: While CHRM3 has been localized to primary cilia in endothelial cells , the molecular mechanisms directing this specialized localization remain unclear. Understanding the trafficking pathways and retention signals for ciliary localization would provide insights into compartmentalized signaling.

  • Interaction with other receptor systems: The potential cross-talk between Chrm3 and other signaling pathways, particularly in tissues showing functional redundancy, requires further investigation. This includes potential interactions with other cholinergic receptors (nicotinic, other muscarinic subtypes) and non-cholinergic systems.

  • Molecular basis of sex differences: The observed sex differences in bladder function in Chrm3 knockout mice suggest sex-specific regulatory mechanisms that remain poorly understood. Identifying the molecular basis for these differences could have implications for sex-specific therapeutic approaches.

  • Temporal dynamics of Chrm3 signaling: Most studies provide snapshots of Chrm3 function rather than dynamic analysis of its signaling over time. Understanding the temporal aspects of Chrm3 activation, desensitization, and downstream signaling would provide a more complete picture of its physiological roles.

  • Vascular-neural interaction mechanisms: While endothelial Chrm3 has been implicated in cognitive functions , the precise mechanisms linking vascular signaling to neural processes remain to be elucidated. This represents an important frontier in understanding neurovascular coupling.

  • Human relevance: Extrapolation from rodent models to human physiology requires validation. Studies in human tissues or cells are needed to confirm the conservation of Chrm3 functions and subcellular localizations observed in animal models.

Addressing these knowledge gaps will require interdisciplinary approaches combining advanced genetic, imaging, and functional methodologies with systems-level analysis across different physiological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.