Recombinant Rat Muscarinic acetylcholine receptor M5 (Chrm5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Chrm5; Chrm-5; Muscarinic acetylcholine receptor M5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-531
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MEGESYNESTVNGTPVNHQALERHGLWEVITIAVVTAVVSLMTIVGNVLVMISFKVNSQL KTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWVLGSLACDLWLALDYVASNASVMNL LVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLVSFILWAPAILCWQYLVGKRTVPPD ECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVAEAKK REPAQRTLLRSFFSCPRPSLAQRERNQASWSSSRRSTSTTGKTTQATDLSADWEKAEQVT TCSSYPSSEDEAKPTTDPVFQMVYKSEAKESPGKESNTQETKETVVNTRTENSDYDTPKY FLSPAAAHRLKSQKCVAYKFRLVVKADGTQETNNGCRKVKIMPCSFPVSKDPSTKGPDPN LSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGY WLCYVNSTINPICYALCNRTFRKTFKLLLLCRWKKKKVEEKLYWQGNSKLP
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates diverse cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is phosphoinositide turnover.
Gene References Into Functions
  1. The relative mRNA expression of M3 and M5 mAChR in bones of a rat osteoporosis model was investigated. PMID: 24866457
  2. This study demonstrated that Somatodendritic targeting of M5 muscarinic receptor in the rat ventral tegmental area: implications for mesolimbic dopamine transmission. PMID: 23504804
  3. M5 receptor is the major muscarinic receptor subtype in rat adrenal medullary cells and may be involved in neuronal transmission under conditions where acetylcholine spills over the synapse PMID: 22095037
  4. In the inflamed bladder, NO seems to be released via cholinergic stimuli through mucosal muscarinic M3/M5 receptors, presumably on urothelial cells, affecting bladder function PMID: 18246091
  5. These results provide further evidence of expression of the M(1) muscarinic receptor subtype in rat heart and show that the heart contains at least one other, albeit minor, muscarinic receptor population, most likely the M(5) muscarinic receptors PMID: 18443764

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM5 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is the Muscarinic Acetylcholine Receptor M5 (Chrm5) and what are its structural features?

The muscarinic acetylcholine receptor M5 (Chrm5) is a G protein-coupled receptor that belongs to the family of five muscarinic receptor subtypes (M1-M5). It is structurally characterized as a seven-transmembrane glycoprotein with 531 residues in humans and 532 residues in mice (89% homologous to human) . The M5 receptor is the next largest muscarinic receptor after the M3 subtype, with both possessing a large third intracellular loop . This third intracellular loop shows the least homology between different species (human and rat) compared to other muscarinic receptor subtypes . The M5 receptor was the last of the muscarinic receptor family to be cloned in humans and is mapped to chromosome 15q26 .

Where is the M5 receptor primarily expressed in the brain?

M5 acetylcholine receptor expression in the brain displays a distinct pattern from the other four G protein-coupled muscarinic receptor subtypes. Through in situ hybridization and reverse-transcriptase PCR studies, M5 AChR has been primarily localized to:

  • Substantia nigra

  • Ventral tegmental area

  • Hippocampus (specifically CA1 and CA2 subfields)

  • Cerebral cortex (particularly the outermost layer)

  • Striatum (caudate putamen)

This specific localization pattern, particularly in regions associated with dopaminergic pathways, suggests its potential role in reward mechanisms and drug abuse behaviors .

What signaling pathways are associated with M5 receptor activation?

The M5 receptor, along with M1 and M3 receptors, couples preferentially via the pertussis toxin-insensitive Gq/11 protein to phosphoinositide C-β (PLC-β) . Activation of these subtypes accelerates the rate of phosphatidylinositol 4,5-bisphosphate (PIP2) hydrolysis, leading to the formation of inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG) . These products act as second messengers by mobilizing Ca2+ from intracellular stores and activating protein kinase(s) C (PCK), respectively .

What are the common methods for expressing recombinant rat M5 receptors?

Several expression systems have been successfully employed for recombinant rat M5 receptor production:

  • Yeast Expression System: The rat M5 muscarinic acetylcholine receptor has been successfully produced in Saccharomyces cerevisiae by placing the M5 gene under the control of the yeast alpha-factor promoter and leader sequence . Northern blotting confirmed the presence of M5 transcripts in the transformed yeast .

  • Mammalian Cell Lines: Chinese Hamster Ovary (CHO) cells have been commonly used for M5 receptor expression studies, particularly for investigating coupling to signaling pathways .

  • A-2058 Human Melanoma Cells: These cells have been reported to endogenously express the M5 receptor, which could provide a useful model system, although extensive use of these cells has not been widely reported .

How can the functionality of expressed rat M5 receptors be assessed?

The functionality of expressed rat M5 receptors can be assessed through multiple approaches:

  • Ligand Binding Studies: Crude extracts prepared from transformed yeast expressing rat M5 receptors have demonstrated saturable binding of the muscarinic antagonist [3H]-N-methyl scopolamine ([3H]NMS) with a Kd of 22.77 nM and Bmax of 134.76 fmole per mg protein .

  • Intact Cell Binding Assays: These assays can confirm successful translocation of the receptor across the membrane of the endoplasmic reticulum and verify that the binding site remains functional .

  • Functional Coupling Assays: Measuring phosphoinositide hydrolysis and calcium mobilization following receptor activation can assess functional coupling to downstream signaling pathways .

  • Immunological Detection: Commercial antibodies such as rabbit polyclonal antibodies against Muscarinic Acetylcholine Receptor M5/CHRM5 are available for Western blot and immunocytochemistry/immunofluorescence applications .

What are the critical amino acid residues for G-protein coupling in the rat M5 receptor?

Through random saturation mutagenesis and point mutation studies, researchers have identified specific amino acids that are critical for G-protein coupling in the M5 receptor:

  • Residues 439, A440, A441: Located towards the C-terminal end of the third intracellular loop, these amino acids play crucial roles in G-protein coupling .

  • Specific Functions:

    • Residue 439: Participates in G-protein activation through an ionic mechanism

    • A440: Fulfills more of a structural role, potentially forming part of the G-protein coupling pocket

    • A441: Contributes to receptor affinity for G-proteins

These findings suggest that the third intracellular loop of the M5 receptor forms a G-protein coupling pocket comprising a positively charged lip and a hydrophobic core .

How do mutational studies inform our understanding of M5 receptor activation mechanisms?

Mutational studies have provided crucial insights into M5 receptor activation mechanisms:

  • Transmembrane Domain VI (TMVI): Mutations spanning the face of TMVI were found to induce high levels of constitutive activity of the receptor. The same face of TMVI contained several residues crucial to receptor activation by agonists, and one residue was identified as a contact site for both agonists and antagonists .

  • Second Intracellular Loop: Systematic studies identified an ordered cluster of residues where substitutions cause constitutive activation of the M5 receptor. A second group of residues in this loop has been identified where mutations compromise receptor/G-protein coupling .

  • Structural Implications: The residues of each group appear to alternate and are spaced three to four positions apart, suggesting an α-helical structure where the groups form opposing faces of the helix. The constitutively activating face normally constrains the receptor in the off state, while the other face couples to G-proteins when the receptor is in the on state .

These findings suggest that within TMVI of the M5 receptor is a molecular switch that defines the activation state of the receptor, with ligand interactions stabilizing the receptor in either active or inactive conformations .

How can researchers distinguish M5 receptor activity from other muscarinic receptor subtypes?

  • Genetic Approaches: Using M5 knock-out (KO) mice or RNA interference techniques to specifically target M5 receptors .

  • Tissue Selection: Focusing on brain regions with high M5 expression and limited expression of other muscarinic receptor subtypes .

  • Recombinant Systems: Expressing only the M5 subtype in cell lines that lack endogenous muscarinic receptors .

  • Signaling Pathway Analysis: Exploiting differences in G-protein coupling efficiency between M5 and other muscarinic receptors (particularly M1 and M3) to distinguish their activities .

  • Immunological Methods: Using antibodies specific to the M5 receptor for protein detection and localization studies .

What evidence supports the role of M5 receptors in drug addiction pathways?

Several lines of evidence support the potential role of M5 receptors in drug addiction pathways:

  • Localization in Reward Circuitry: The M5 receptor's localization in the substantia nigra, ventral tegmental area, and striatum positions it within key brain reward circuits .

  • Morphine Reward Effects: Studies with M5 knock-out mice have demonstrated that the usual rewarding effect of morphine (measured using a conditioned place-preference test) was greatly reduced compared to wild-type mice .

  • Historical Context: There is a long historical use of muscarinic antagonists such as scopolamine for "the opium habit" and "detoxification of heroin addiction," suggesting that M5 receptors might be one of the targets on which scopolamine acts in the brain .

  • Regulation of Dopamine Release: M5 AChR involvement in the regulation of striatal dopamine release and rewarding brain stimulation suggests a potential role in modulating hedonic responses, including those associated with drug use .

What are the challenges in developing selective ligands for the M5 receptor?

Developing selective ligands for the M5 receptor has proven challenging for several reasons:

  • High Sequence Homology: The high degree of sequence homology within the orthosteric binding sites of the five muscarinic receptor subtypes makes it difficult to develop subtype-selective ligands .

  • Limited Expression: The relatively limited expression of M5 receptors compared to other muscarinic receptor subtypes has complicated pharmacological characterization studies .

  • Lack of Selective Tools: As noted in the literature, "no selective high-affinity ligands or toxins were available" for the M5 receptor, which has hampered research progress .

  • Complex Signaling Profile: The M5 receptor's unique signaling profile, including differences in G-protein coupling compared to other subtypes, presents additional challenges for ligand development and screening .

How does the rat M5 receptor differ from human and mouse M5 receptors?

The M5 receptor shows notable species differences:

  • Sequence Homology: The human M5 receptor consists of 531 residues, while the mouse version has 532 residues and is 89% homologous to the human receptor .

  • Third Intracellular Loop: Of the five muscarinic receptors, the M5 subtype demonstrates the least homology in the third intracellular loop when comparisons are made between human and rat sequences . This is significant as this region is critical for G-protein coupling and downstream signaling.

  • Functional Implications: These structural differences may result in species-specific pharmacological responses and signaling properties, which researchers should consider when translating findings across species models.

What established protocols exist for functional assays of recombinant rat M5 receptors?

Several established protocols have been documented for assessing the functionality of recombinant rat M5 receptors:

  • Radioligand Binding Assays: Using [3H]-N-methyl scopolamine ([3H]NMS) to measure receptor binding properties (Kd and Bmax) in membrane preparations or intact cells .

  • Phosphoinositide Hydrolysis Assay: Measuring the accumulation of inositol phosphates following receptor activation to assess coupling to the Gq/11-PLC-β pathway .

  • Calcium Mobilization Assays: Monitoring intracellular calcium release using fluorescent indicators to assess functional coupling of the receptor to calcium signaling pathways .

  • Cyclic AMP Accumulation Assay: Comparing the ability of M5 receptors versus other muscarinic receptor subtypes (e.g., M3) to stimulate cyclic AMP production via Gs coupling .

  • Immunocytochemistry/Immunofluorescence: Using specific antibodies to visualize receptor expression and localization in cells .

These methodological approaches provide researchers with a comprehensive toolkit for characterizing recombinant rat M5 receptors in various experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.