Recombinant Rat Myelin and lymphocyte protein (Mal)

Shipped with Ice Packs
In Stock

Description

Myelin Maintenance

  • Localizes to compact myelin in oligodendrocytes and Schwann cells .

  • Facilitates trafficking of neurofascin 155 (NF155) and potassium channels (Kv1.2) to paranodal regions .

  • Critical for glycosphingolipid-enriched membrane microdomain formation .

Lymphocyte Function

  • Mediates T-cell receptor (TCR) signaling by transporting Src-like kinases (Lck, Fyn) to lipid rafts .

  • Regulates exosome secretion in T-cells; interacts with HIV-Nef protein to enhance exosomal CD63 sorting .

Cancer Association

  • Pro-Tumorigenic Role: Overexpressed in ovarian cancer and lymphomas (e.g., primary mediastinal B-cell lymphoma), correlating with poor prognosis .

  • Anti-Tumorigenic Role: Downregulated in head/neck squamous carcinomas due to promoter hypermethylation .

Toxin Interactions

  • Serves as the receptor for Clostridium perfringens ε-toxin (ETX) .

  • Rat Mal confers ~100× higher ETX sensitivity than human Mal due to extracellular loop variations .

Recombinant Production

  • Expression: Full-length rat Mal (1-153 aa) cloned into E. coli vectors .

  • Purification: Affinity chromatography using His-tag .

  • Stability: Lyophilized form retains activity for >6 months at -80°C; reconstitution in sterile water with glycerol recommended .

Research Applications

ApplicationUse CaseReference
ELISA KitsQuantify Mal in serum, plasma, and tissue homogenates (detection limit: 0.156 ng/mL)
Cancer StudiesInvestigate MAL’s dual role in tumor progression/suppression
Neurological ResearchStudy myelin biogenesis defects in multiple sclerosis models
Toxin Mechanism AnalysisCharacterize ETX binding and blood-brain barrier disruption

Mechanistic Studies

  • MAL knockout mice resist ETX at doses 1,000× lethal to wild-type mice .

  • MAL overexpression in transgenic mice causes renal and neuronal hyperplasia .

Clinical Correlations

  • Hypomethylation of the MAL promoter correlates with ovarian cancer aggressiveness .

  • MAL immunohistochemistry distinguishes primary mediastinal B-cell lymphoma from other diffuse large B-cell lymphomas .

Challenges and Future Directions

  • Species Variability: Rat Mal’s higher ETX sensitivity complicates cross-species extrapolation .

  • Therapeutic Targeting: Dual oncogenic/tumor-suppressive roles necessitate context-specific drug design .

  • Neurological Implications: MAL’s role in myelin-axon integrity warrants exploration in demyelinating diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mal; Mvp17; Myelin and lymphocyte protein; 17 kDa myelin vesicular protein; MVP17; NS 3; T-lymphocyte maturation-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mal
Target Protein Sequence
MAPAAASGGSTLPSGFSVFVTFPDLLFIFEFIFGGLVWILIASSLVPMPLVQGWVMFVSV FCFLATTSLMVMYIIGTHGGETSWITLDAAYHCVAALFYLSASVLEALATITMFDGFTYR HYHENIAAVVFAYVATLLYVIHAVFSLIRWKSS
Uniprot No.

Target Background

Function
Myelin and lymphocyte protein (Mal) plays a crucial role in vesicular trafficking, cycling between the Golgi complex and the apical plasma membrane. It may also be involved in myelin biogenesis and function.
Gene References Into Functions
  1. Studies suggest that expressing Mal in cells confers both ETX (Clostridium perfringens epsilon-toxin) binding and susceptibility to ETX-mediated cell death. Cells expressing rat Mal are 100 times more sensitive to ETX than cells expressing human Mal. PMID: 25993478
  2. Significant upregulation of Mal in retinal ganglion cells after optic nerve crush has been observed. PMID: 24878628
  3. This is the first report describing changes in Mal expression in gray matter after spinal cord injury. Our findings indicate that Mal might play a role in CNS pathophysiology following SCI. PMID: 23196718
  4. Mal, but not Mal2, self-associates with higher-order cholesterol-dependent complexes with apical proteins, promoting the formation of detergent-resistant membranes that recruit apical proteins. PMID: 21732912
  5. Loss of Mal expression is associated with precancerous lesions of the esophagus. PMID: 17151798

Show More

Hide All

Database Links
Protein Families
MAL family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Exclusively expressed in white and gray matter oligodendrocytes in the CNS and in myelinating Schwann cells in peripheral nerves. Higher levels are found in the PNS than in the CNS or spinal cord, in the gray matter than in the white. Weak expression also

Q&A

What is Rat Myelin and Lymphocyte Protein (MAL) and what are its key structural features?

Rat Myelin and Lymphocyte Protein (MAL) is a small hydrophobic protein of approximately 17 kDa with four putative transmembrane domains expressed primarily in oligodendrocytes and Schwann cells, the myelinating cells of the nervous system. It is also expressed in kidney, spleen, and intestine. Biochemical analysis classifies MAL as a proteolipid that is present in detergent insoluble complexes typical for proteins associated with glycosphingolipids . In myelin, MAL is localized to compact myelin in a pattern similar to established structural myelin proteins like myelin basic protein and proteolipid protein. In kidney and stomach epithelia, MAL is found almost exclusively on the apical (luminal) membranes of cells lining structures such as distal tubuli . The protein's association with glycosphingolipids suggests it plays a role in forming and maintaining stable protein-lipid microdomains in specialized plasma membranes .

How does rat MAL differ from human MAL in experimental contexts?

While rat and human MAL share significant structural homology as tetraspan proteolipids, they exhibit important functional differences in experimental settings. Most notably, cells expressing rat MAL are approximately 100 times more sensitive to Clostridium perfringens epsilon toxin (ETX) than cells expressing comparable levels of human MAL . This dramatic species-specific difference in ETX sensitivity has significant implications for translational research and toxicology studies. Native Chinese Hamster Ovary (CHO) cells, which are normally resistant to ETX, become susceptible to ETX-mediated cell death when transfected with rat MAL . The second extracellular loop appears particularly important for functionality, as insertion of a FLAG sequence into this region abolishes ETX binding and cytotoxicity . These species differences must be carefully considered when extrapolating findings from rat models to human disease mechanisms.

What is the significance of MAL in neurological disease research?

MAL has emerged as a protein of interest in neurological disease research, particularly in relation to Multiple Sclerosis (MS). ETX from Clostridium perfringens has been proposed as a potential causative agent for MS, a human disease characterized by blood-brain barrier (BBB) dysfunction and injury to myelin-forming cells of the central nervous system . Since MAL is required for both binding of ETX to mammalian cells and ETX cytotoxicity, it represents a critical link in this pathogenic pathway . ETX binding occurs specifically to tissues expressing MAL, including intestinal epithelium, renal tubules, brain endothelial cells, myelin, and retinal microvasculature . Studies with MAL knockout (MAL-/-) mice demonstrate complete absence of ETX binding to these tissues and remarkable resistance to ETX toxicity even at doses exceeding 1000 times the symptomatic dose for wild-type mice . These findings position MAL as a potential therapeutic target in neurological conditions involving BBB dysfunction or oligodendrocyte injury.

What expression systems are most effective for producing functional recombinant rat MAL?

Due to MAL's hydrophobic nature and multiple transmembrane domains, mammalian expression systems generally yield the most functionally relevant recombinant protein. The most validated approach involves transfection of Chinese Hamster Ovary (CHO) cells, which do not natively express MAL and are resistant to ETX . When rat MAL is exogenously expressed in CHO cells, they gain both ETX binding capacity and susceptibility to ETX-mediated cell death, confirming functional expression . When designing expression constructs, researchers should avoid modifying the second extracellular loop, as this region is critical for ETX binding; insertion of even small tag sequences like FLAG in this region abolishes functionality . For structural studies requiring higher protein yields, insect cell systems can be considered, though post-translational modifications may differ from mammalian systems and should be validated for functional equivalence.

How can researchers assess the functionality of recombinant rat MAL?

Functional assessment of recombinant rat MAL requires multiple complementary approaches:

  • ETX binding assays: The most direct functional test is to verify that cells expressing recombinant rat MAL gain the ability to bind ETX, which can be visualized using labeled toxin preparations .

  • Cytotoxicity assays: Functional MAL confers susceptibility to ETX-mediated cell death, which can be quantified using cell viability assays .

  • Detergent resistance profiling: Properly folded MAL should partition into detergent-insoluble membrane fractions enriched in glycosphingolipids .

  • Immunolocalization: In polarized cells, functional MAL should correctly localize to apical membranes or specialized membrane domains .

  • Glycosphingolipid association: Co-immunoprecipitation or co-fractionation with glycosphingolipids like galactosylceramide and sulfatide indicates proper membrane microdomain formation .

Researchers should include appropriate positive controls (native MAL-expressing tissues) and negative controls (MAL knockout tissues or cells with modified MAL lacking the second extracellular loop) to validate their functional assessments .

What technical challenges are associated with purifying recombinant rat MAL, and how can they be addressed?

Purification of recombinant rat MAL presents significant technical challenges due to its hydrophobic nature and tight association with membrane lipids. Key challenges and solutions include:

  • Detergent selection: MAL's association with glycosphingolipids necessitates careful detergent selection to maintain native-like membrane environments. Mild detergents like n-dodecyl-β-D-maltoside or digitonin better preserve protein-lipid interactions than harsh detergents like SDS or Triton X-100 .

  • Lipid preservation: Including specific lipids during purification, particularly glycosphingolipids like galactosylceramide and sulfatide, helps maintain MAL's native conformation and functionality .

  • Protein aggregation: MAL's hydrophobic domains predispose it to aggregation during purification. Strategies to minimize aggregation include maintaining cold temperatures throughout purification, including glycerol in buffers, and minimizing exposure to air interfaces.

  • Tag interference: Affinity tags for purification must be positioned to avoid the second extracellular loop, which is critical for ETX binding . N-terminal tags generally cause less functional interference than C-terminal tags or internal tags.

  • Functional verification: Each purification batch should be assessed for functionality using binding assays or reconstitution into liposomes followed by ETX binding tests to ensure the purification process hasn't compromised protein function.

How can recombinant rat MAL be used to study Clostridium perfringens epsilon toxin (ETX) pathogenesis?

Recombinant rat MAL provides a powerful tool for dissecting ETX pathogenesis mechanisms:

  • Receptor identification: The discovery that MAL is required for ETX binding and cytotoxicity has resolved long-standing questions about the cellular receptor for this potent toxin . Recombinant MAL expression systems allow detailed characterization of the molecular interactions between ETX and its receptor.

  • Structure-function studies: By creating targeted mutations in recombinant rat MAL, researchers can identify specific domains critical for ETX binding. For example, modifications to the second extracellular loop abolish ETX binding and cytotoxicity .

  • Species specificity investigation: The observation that rat MAL is approximately 100 times more sensitive to ETX than human MAL offers an opportunity to identify structural determinants of ETX sensitivity through chimeric constructs and point mutations .

  • Toxin variant testing: Recombinant MAL expression systems provide a platform for evaluating modified toxins with reduced toxicity, such as the Y30A-Y196A-A168F variant that shows significantly reduced toxicity toward CHO cells expressing sheep MAL . This has applications in vaccine development.

  • Blood-brain barrier studies: Since MAL is expressed in brain endothelial cells and ETX causes blood-brain barrier dysfunction, recombinant MAL systems can help elucidate mechanisms of toxin-induced barrier disruption relevant to neurological diseases .

What approaches are available for studying MAL-lipid interactions in membrane microdomains?

Understanding MAL-lipid interactions requires specialized methodologies:

TechniqueApplicationAdvantagesLimitations
Detergent Resistance ProfilingIdentifies MAL association with lipid raftsSimple methodology, well-establishedDetergents can create artifacts
Fluorescence Resonance Energy Transfer (FRET)Measures proximity between MAL and specific lipidsWorks in living cells, high sensitivityRequires fluorescent labeling
Atomic Force MicroscopyVisualizes MAL distribution in membrane domainsHigh resolution, works with native membranesTechnical complexity, sample preparation challenges
Lipidomic AnalysisIdentifies lipids co-purifying with MALComprehensive lipid identificationRequires specialized mass spectrometry
Reconstitution in Model MembranesTests MAL function in defined lipid environmentsPrecise control of membrane compositionMay not replicate complex native environments

In native environments, MAL shows particular association with glycosphingolipids including galactosylceramide and sulfatide, which are especially enriched in myelin membranes . These specific lipid interactions appear critical for MAL's function in forming and maintaining stable protein-lipid microdomains in specialized membranes like myelin and apical epithelial surfaces .

How might mutations in recombinant rat MAL inform structure-function relationships?

Strategic mutagenesis of recombinant rat MAL has revealed critical insights about protein structure-function relationships:

  • Second extracellular loop: Insertion of a FLAG sequence into this region completely abolishes ETX binding and cytotoxicity, identifying this domain as essential for toxin interaction . Point mutations in this region could further delineate specific residues involved in the binding interface.

  • Transmembrane domains: Mutations affecting membrane integration might disrupt association with glycosphingolipids and consequent microdomain formation. The four transmembrane domains appear essential for proper localization to detergent-resistant membrane domains .

  • Species-specific differences: Creating chimeric constructs that swap domains between rat and human MAL could pinpoint regions responsible for the 100-fold difference in ETX sensitivity . This approach could identify specific amino acid residues that determine species-specific toxin interactions.

  • In silico mutation studies: Computational approaches have suggested that substituting aromatic with aliphatic amino acid residues in ETX could reduce its binding efficiency to MAL protein receptors . Similar approaches could be applied to predict MAL mutations that might affect ETX binding.

  • Glycosphingolipid binding motifs: Targeted mutations in putative lipid interaction sites could help define how MAL specifically associates with glycosphingolipids to form membrane microdomains .

What factors might influence the reproducibility of experiments using recombinant rat MAL?

Several factors can affect experimental reproducibility when working with recombinant rat MAL:

  • Expression levels: Variable expression levels between experiments can significantly impact assay outcomes, particularly in toxin binding and cytotoxicity studies. Quantitative western blotting or flow cytometry should be used to normalize expression levels .

  • Membrane composition: The lipid environment, particularly the presence of specific glycosphingolipids, can dramatically affect MAL function. Cell culture conditions that alter membrane composition (serum lot, growth supplements) may introduce variability .

  • Protein tagging: Tags for detection or purification can interfere with function, especially if placed near the second extracellular loop. Consistent tag placement and validation of tagged construct functionality are essential .

  • Cell line heterogeneity: Clonal drift in stable cell lines or passage-dependent changes in transiently transfected cells can introduce variability. Regular verification of MAL expression and functionality is recommended.

  • Toxin preparation: When using ETX for functional assays, batch-to-batch variations in toxin preparation, activation status, and storage conditions can affect results. Standardized toxin preparations with validated activity should be used .

How can researchers differentiate between effects on MAL expression versus function?

Distinguishing between expression and functional defects requires systematic analysis:

  • Quantitative expression analysis: Western blotting with calibrated standards or flow cytometry with standardized beads can provide absolute quantification of MAL expression levels to normalize functional data .

  • Subcellular localization: Immunofluorescence microscopy can verify proper trafficking to appropriate membrane domains. Mislocalized MAL may be expressed but nonfunctional .

  • Glycosylation and post-translational modifications: Western blotting under conditions that preserve modifications can reveal differences in processing that might affect function while protein levels remain constant.

  • Detergent resistance profiling: Properly folded and functional MAL should partition into detergent-resistant membrane fractions. Shifts in detergent solubility suggest conformational or lipid association defects rather than expression changes .

  • Dose-response analysis: Constructing complete dose-response curves for ETX binding or cytotoxicity, rather than single-point measurements, can help distinguish partial functional impairment from complete loss of function or reduced expression .

What controls are essential for validating recombinant rat MAL functionality?

Rigorous experimental design requires several types of controls:

  • Positive tissue controls: Native tissues known to express MAL (myelin, kidney epithelium) provide benchmarks for physiological expression patterns and functional responses .

  • Genetic knockout controls: MAL knockout (MAL-/-) tissues or cells demonstrate the specificity of MAL-dependent effects. These knockouts show complete absence of ETX binding and resistance to toxicity, confirming MAL's essential role .

  • Species comparison controls: Given the ~100-fold difference in ETX sensitivity between rat and human MAL, parallel testing of both provides an internal validation of the assay system and helps calibrate dose-response relationships .

  • Binding-deficient mutants: MAL constructs with modifications to the second extracellular loop (e.g., FLAG insertion) that abolish ETX binding serve as important negative controls to confirm specificity .

  • Empty vector controls: Cells transfected with expression vector lacking the MAL sequence control for non-specific effects of the transfection process or vector-derived proteins .

How might emerging technologies advance the structural characterization of rat MAL?

Several cutting-edge technologies hold promise for elucidating MAL structure:

  • Cryo-electron microscopy: Recent advances in cryo-EM for membrane proteins could potentially resolve the three-dimensional structure of MAL in lipid nanodiscs or detergent micelles, particularly if bound to ETX to stabilize the complex.

  • Hydrogen-deuterium exchange mass spectrometry: This approach can identify solvent-accessible regions and conformational changes upon ligand binding without requiring crystallization.

  • Single-molecule FRET: By labeling specific domains of MAL, conformational dynamics and structural changes upon interaction with ETX or specific lipids could be monitored in real-time.

  • Solid-state NMR: This technique is well-suited for membrane proteins like MAL and could provide atomic-level structural information, particularly regarding transmembrane domain organization.

  • Integrative structural biology: Combining computational modeling with experimental constraints from multiple techniques could overcome limitations of individual approaches for this challenging membrane protein.

What are the potential applications of MAL research for developing therapeutics or diagnostic tools?

MAL research offers several translational opportunities:

  • ETX neutralization strategies: Understanding the MAL-ETX interaction could lead to development of neutralizing antibodies or small molecules that prevent toxin binding, protecting against ETX-mediated neurological damage .

  • Multiple sclerosis therapeutics: If the proposed link between ETX, MAL, and Multiple Sclerosis is validated, targeted therapies disrupting this pathway could offer new treatment approaches for this debilitating disease .

  • Blood-brain barrier protection: Agents that modulate MAL-dependent pathways at the blood-brain barrier might prevent pathological BBB breakdown in various neurological conditions .

  • Diagnostic tools: MAL-based detection systems could improve sensitivity for detecting ETX in biological samples or environmental testing, potentially enabling earlier intervention in animal outbreaks or suspected human exposures .

  • Vaccine development: Modified toxin variants with reduced MAL binding, such as Y30A-Y196A-A168F, have been proposed as next-generation enterotoxemia vaccines with improved safety profiles .

How could CRISPR/Cas9 genome editing advance understanding of MAL function in complex tissues?

CRISPR/Cas9 technology offers powerful new approaches for MAL research:

  • Precise knock-in models: Introduction of specific mutations to recapitulate disease variants or create reporter fusions at endogenous loci while maintaining native expression regulation.

  • Conditional systems: Development of floxed MAL alleles for tissue-specific or temporally controlled deletion to distinguish developmental from maintenance roles in myelinating cells and epithelia.

  • Humanized animal models: Replacement of rodent MAL with human MAL sequences would create better translational models, particularly for ETX sensitivity studies given the significant species differences .

  • Paralog analysis: Systematic editing of MAL family members could reveal functional redundancy or specialization in different tissues or developmental stages.

  • High-throughput screening: Genome-wide CRISPR screens in MAL-expressing cells could identify new interaction partners or regulatory pathways affecting MAL function in membrane microdomain organization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.