Recombinant Rat Myelin-oligodendrocyte glycoprotein (Mog)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Myelin-Oligodendrocyte Glycoprotein (MOG)

Myelin oligodendrocyte glycoprotein (MOG) is a distinctive element found on the surface of oligodendrocytes and the outermost myelin sheaths in the central nervous system (CNS) . As a 28 kDa single-pass transmembrane glycoprotein, MOG belongs to the immunoglobulin superfamily . It is crucial for the proper myelination and function of the nervous system . Recombinant Rat MOG is a laboratory-produced version of this protein, utilizing rat genetic material. It is designed to mimic the structure and function of the native rat MOG protein, serving as a valuable tool in research contexts .

Structure and Characteristics of MOG

MOG has a well-defined structure, which includes:

  • A signal sequence of 28 amino acids (in mice, 29 in humans)

  • An extracellular domain (ECD) of 128 amino acids containing an Ig-like domain (125 aa in humans)

  • A transmembrane domain of 21 amino acids

  • A cytosolic fragment of 69 amino acids featuring a hydrophobic domain (72 aa in humans)

The ECD of rat MOG shares a high degree of amino acid sequence identity with both human (90%) and mouse (95%) MOG . MOG's extracellular Ig-like domain facilitates dimerization . Uniquely, human MOG has multiple splice variants, including a soluble ECD isoform and isoforms with a truncated cytoplasmic domain, unlike its mouse and rat counterparts .

Role and Significance

MOG is exclusively expressed by oligodendrocytes within the CNS and is found on the outer layer of the myelin sheath and the oligodendrocyte plasma membrane . Its expression levels in the brain serve as a temporal biomarker for myelin development . The protein's role in autoimmune demyelination has been highlighted in studies, suggesting its importance in conditions such as multiple sclerosis (MS) .

Recombinant Rat MOG in Experimental Autoimmune Encephalomyelitis (EAE)

Recombinant Rat MOG is often employed in studies of experimental autoimmune encephalomyelitis (EAE), an animal model for multiple sclerosis . The use of recombinant MOG protein allows researchers to induce EAE in animal models, like Lewis rats, and to study the resulting demyelinating diseases of the CNS .

Experiments have shown that autoimmune responses to the N-terminal domain (amino acids 1-125) of MOG can induce an acute demyelinating variant of EAE . Immunization with recombinant MOG induces inflammation and focal demyelinating lesions in the CNS . The synergy between MOG-specific T cell and autoantibody responses mediates this inflammatory demyelinating pathology .

Pathogenicity of MOG Antibodies

The role of myelin oligodendrocyte glycoprotein (MOG) antibodies in optic neuritis (ON) is notable, with MOG antibody-associated disease (MOGAD) presenting ON as a frequent symptom . The presence of autoantibodies against MOG (MOG-IgG) is a hallmark of MOGAD . Human MOG-IgG that cross-reacts with rodent MOG can increase T-cell infiltration and complement deposition in rat models . MOG-IgG can directly affect oligodendrocytes, altering their cytoskeleton and protein phosphorylation patterns and can change the expression of axonal proteins .

MOG and Autoimmune Demyelination

Studies indicate that MOG is a target for pathogenic autoantibodies, which are implicated in the early stages of MS . Antibodies targeting native MOG epitopes are frequently found in patients with clinically isolated syndromes and relapsing-remitting MS . Detecting these antibodies using cell-based assays may provide a practical marker for early detection of CNS autoimmune demyelination .

Effects of MOG on Oligodendrocytes

Research has demonstrated that the binding of antibodies to MOG on the surface of oligodendrocytes can cause MOG to be repartitioned into lipid rafts, followed by changes in the phosphorylation status of multiple proteins . These changes can lead to alterations in the cytoarchitecture of oligodendrocytes, affecting the stability of the cytoskeleton .

MOG Peptide-Induced EAE

Studies involving the inoculation of MOG peptides into mice have provided insights into T cell responses and the immunoproteasome's role in EAE . EAE incidence and severity, along with the induction of CD4+ and CD8+ T cells, were evaluated in wild-type mice and LMP-2KO mice (lacking an intact immunoproteasome) . The results indicated that the immunoproteasome does not play a critical role in demyelinating disease development, as EAE progression was similar in both groups .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mog; Myelin-oligodendrocyte glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-245
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Mog
Target Protein Sequence
GQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAE QAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFY WINPGVLALIALVPMLLLQVSVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Uniprot No.

Target Background

Function
Recombinant Rat Myelin-oligodendrocyte glycoprotein (MOG) mediates homophilic cell-cell adhesion and is a minor component of the myelin sheath. It may be involved in myelin sheath formation and maintenance, as well as cell-cell communication.
Database Links
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Q&A

What is MOG and why is it important in neuroscience research?

Myelin Oligodendrocyte Glycoprotein (MOG) is a 28 kDa single-pass transmembrane glycoprotein belonging to the immunoglobulin superfamily. Despite comprising only 0.01-0.05% of CNS myelin proteins, MOG serves as a crucial autoantigen in multiple sclerosis research and experimental autoimmune encephalomyelitis (EAE) in various animal models. Its exclusive expression in the central nervous system by oligodendrocytes, specifically in the outer layer of the myelin sheath, makes it an ideal target for studying demyelinating disorders .

What is the typical structure of recombinant rat MOG used in research?

Recombinant rat MOG typically consists of the extracellular domain (amino acids 1-125) of the full protein. The molecular weight of recombinant rat MOG is approximately 14.2 kDa. Most commercially available and laboratory-produced preparations include a 6x His tag to facilitate purification. The protein is expressed in E. coli from the sequence corresponding to the extracellular domain of rat MOG (Accession #CAE84068) and purified from urea-denatured bacterial lysate using immobilized metal affinity chromatography (IMAC) .

How does rat MOG compare structurally to human and mouse MOG?

Rat MOG shares approximately 90% sequence homology with human MOG in the extracellular domain. The mouse MOG extracellular domain shares 95% amino acid sequence identity with rat MOG and 90% with human MOG. Despite this high homology, these proteins expose distinct conformational epitopes that affect antibody binding and pathogenicity. These differences are critical when designing cross-species studies or interpreting results from different animal models .

What expression systems are used for producing recombinant rat MOG?

E. coli is the predominant expression system for producing recombinant rat MOG. The protein is typically expressed with the sequence corresponding to the extracellular domain along with a His tag for purification purposes. The bacterial expression system allows for high yields of protein, though proper refolding is essential for maintaining conformational epitopes .

How is the quality and activity of recombinant rat MOG assessed?

Quality assessment of recombinant rat MOG includes:

  • Purity evaluation using SDS-PAGE (typically >95% purity)

  • Endotoxin testing using Limulus Amebocyte Lysate (LAL) quantitative kinetic assay (should be <0.1 EU per 1 μg)

  • Biological activity testing through induction of EAE in susceptible rodent strains

  • Western blot analysis using MOG-specific antibodies such as monoclonal antibody 8-18C5

  • ELISA for detecting proper folding and epitope exposure

What are the optimal storage conditions for maintaining recombinant rat MOG stability?

Recombinant rat MOG is typically supplied as a sterile, frozen solution (1 mg/ml) in 25 mM sodium acetate buffer (pH 4.0). For long-term storage, it should be kept at -80°C, and repeated freeze-thaw cycles should be avoided to maintain protein integrity and conformational epitopes. Some preparations may be lyophilized from a 0.2 μm filtered solution in PBS and reconstituted at 100 μg/mL in PBS before use .

What are the protocols for inducing EAE using recombinant rat MOG?

For EAE induction in rodents using recombinant rat MOG:

  • Female DA rats or Lewis rats (7-9 weeks old) are typically used

  • Animals are immunized subcutaneously at the tail base with 50-75 μg of rat MOG per animal

  • Complete Freund's adjuvant is used as an immune stimulant

  • EAE symptoms typically develop within 10-14 days, presenting as limp tail, hind limb weakness, hind limb paralysis, and weight loss

  • Animals should be monitored daily for clinical signs of disease progression

How do different MOG isoforms affect experimental outcomes?

Different MOG isoforms (rat, human, or mouse) expose distinct conformational epitopes that significantly affect experimental outcomes:

  • All MOG proteins can induce high antibody titers as detected by ELISA

  • Only certain MOG isoforms (like human MOG) induce encephalitogenic antibodies in primed B cell-deficient mice

  • Pathogenic antibodies bind specifically to glycosylated MOG and live oligodendrocytes

  • Non-pathogenic antibodies may still bind recombinant MOG and deglycosylated MOG in myelin

  • The epitope recognized by pathogenic antibodies may be conformation-dependent rather than linear sequence-dependent

This variability highlights the importance of carefully selecting the appropriate MOG isoform for specific research questions.

How do conformational epitopes of MOG influence antibody pathogenicity?

Conformational epitopes of MOG are critical determinants of antibody pathogenicity. Research has identified distinct epitopes exposed on different MOG isoforms:

  • Some epitopes (recognized by mAb 8.18c5 and M26) are common to all MOG isoforms

  • Other epitopes (recognized by Fab M3-24) are length-dependent but species-independent

  • Some epitopes (recognized by Fab M3-8) are species-dependent

Only pathogenic antibodies bind to live oligodendrocytes and induce repartitioning of MOG into lipid rafts after cross-linking, leading to dramatic changes in oligodendrocyte morphology. This lipid raft redistribution appears to be a key mechanism in antibody-mediated demyelination .

What cellular mechanisms underlie MOG antibody-mediated demyelination?

The pathogenic mechanism of MOG antibody-mediated demyelination involves:

  • Binding of antibodies to conformational epitopes on oligodendrocyte surface MOG

  • Cross-linking of surface MOG leading to its rapid repartitioning from detergent-soluble to insoluble fractions with characteristics of lipid rafts

  • Changes in phosphorylation status of at least 10 proteins following MOG redistribution

  • Alterations in oligodendrocyte cytoarchitecture, including process retraction

  • Changes in cytoskeletal stability leading to demyelination

These cellular events provide a biochemical mechanism linking in vivo observations with in vitro findings regarding demyelinating disease .

How can researchers differentiate between pathogenic and non-pathogenic anti-MOG antibodies?

Differentiating pathogenic from non-pathogenic anti-MOG antibodies requires multiple assays:

  • Binding to live oligodendrocytes: Only pathogenic antibodies bind to the surface of live oligodendrocytes in culture

  • Effect on oligodendrocyte morphology: Pathogenic antibodies, when cross-linked with secondary antibodies, induce dramatic morphological changes in oligodendrocytes

  • MOG redistribution assay: Pathogenic antibodies cause repartitioning of MOG into detergent-insoluble fractions (lipid rafts)

  • Glycosylation-dependent binding: Pathogenic antibodies specifically recognize glycosylated MOG

  • In vivo transfer: Only pathogenic antibodies exacerbate EAE when transferred to animals with T-cell-mediated inflammation

What techniques are used to detect anti-MOG antibodies in experimental samples?

Multiple techniques are employed to detect and characterize anti-MOG antibodies:

  • ELISA: Detects antibody binding to plate-bound MOG, providing quantitative titer information but not distinguishing pathogenic from non-pathogenic antibodies

  • Western blot analysis: Detects antibody binding to denatured MOG, useful for epitope mapping but not reflecting binding to native conformations

  • Cell-based assays: Using MOG-expressing cell lines to detect antibodies that recognize cell-surface, natively folded MOG

  • Immunocytochemistry with live oligodendrocytes: Most physiologically relevant for detecting pathogenic antibodies

  • In vivo transfer models: Gold standard for determining pathogenicity of MOG antibodies

How can researchers ensure proper folding of recombinant rat MOG for immunological studies?

Ensuring proper folding of recombinant rat MOG involves:

  • Using optimized refolding protocols after purification from bacterial inclusion bodies

  • Verifying proper disulfide bond formation in the immunoglobulin-like domain

  • Confirming binding to conformation-specific antibodies like 8-18C5

  • Assessing biological activity through pilot EAE induction experiments

  • Analyzing oligodendrocyte binding capacity in cell culture systems

  • Testing for the exposure of known conformational epitopes using panel antibodies with defined specificities

What factors influence variability in EAE induction using recombinant rat MOG?

Several factors contribute to variability in EAE induction:

  • MOG preparation quality: Proper folding and conformational epitope preservation

  • Animal strain differences: DA rats and Lewis rats show different susceptibilities and clinical manifestations

  • Age and gender of animals: Female rats aged 7-9 weeks show optimal responses

  • Adjuvant formulation: Complete Freund's adjuvant composition affects immune response intensity

  • Immunization protocol: Injection site, volume, and technique influence disease development

  • Housing conditions: Stress levels and microbiome can affect EAE susceptibility and severity

  • Protein storage conditions: Repeated freeze-thaw cycles can compromise MOG conformational epitopes

How can researchers address inconsistent antibody responses to recombinant rat MOG?

To address inconsistent antibody responses:

  • Verify protein quality using SDS-PAGE and Western blotting with 8-18C5 antibody

  • Test multiple detection methods, as some antibodies may recognize conformational rather than linear epitopes

  • Consider the glycosylation status of MOG, as some pathogenic antibodies specifically recognize glycosylated forms

  • Use positive controls like the monoclonal antibody 8-18C5 for validation

  • Ensure proper storage of both MOG protein and serum samples to maintain epitope integrity

  • Compare results across different MOG isoforms (rat, human, mouse) to identify species-specific responses

How are MOG epitope mapping techniques evolving to better understand MS pathogenesis?

Advanced epitope mapping approaches include:

  • Crystal structure analysis of MOG complexed with antibody fragments

  • Use of recombinant MOG isoforms with specific mutations to identify critical binding residues

  • Comparison of epitopes recognized by antibodies from different species and disease models

  • Analysis of conformational epitopes using hydrogen-deuterium exchange mass spectrometry

  • Computational modeling of antibody-antigen interactions to predict pathogenic epitopes

These approaches help differentiate between disease-relevant and non-pathogenic epitopes, potentially leading to more specific diagnostic tests and therapeutic interventions for MS .

What are the implications of MOG glycosylation for antibody recognition and pathogenicity?

MOG glycosylation significantly impacts antibody recognition and pathogenicity:

  • Pathogenic antibodies preferentially bind glycosylated MOG while non-pathogenic antibodies may bind both glycosylated and deglycosylated forms

  • Enzymatic deglycosylation of myelin MOG alters antibody binding profiles

  • Glycosylation patterns may differ between species, affecting cross-reactivity of antibodies

  • Post-translational modifications of MOG may create neo-epitopes that are targets of autoimmune responses

  • Glycosylation may influence MOG's localization in lipid rafts and its susceptibility to antibody-mediated crosslinking

Understanding these glycosylation-dependent interactions may lead to more specific therapeutic approaches targeting pathogenic antibody responses in MS .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.