Recombinant Rat Myeloid-associated differentiation marker-like protein 2 (Myadml2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly include them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs unless otherwise specified. If you require dry ice shipping, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Myadml2; Myeloid-associated differentiation marker-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Myadml2
Target Protein Sequence
MGSTMEPPGGAYLHLGAVTSPVGTARMLQLAFGCTTFSLVAHRGGFGGVQGTFCMAAWGF CFAFSVLVVACEFTRLHSCLRLSWGNFTAAFAMLATLLCATAAVIYPLYFTRLECPPEPA GCMVRNFRLAASVFAGLLFLAYAAEVALTRARPGQVASYMATVSGLLKIVQAFVACIIFG ALVHESRYGRYVATQWCVAVYSLCFMATVAVVVLSVMGHTGGLGCPFDRLVVVYTFLAVL LYLSAAVIWPVFCFDPKYGEPGRPSDCPRGSCPWDSQLVVAIFTYVNLLLYIVDLAYSQR IRFVPTL
Uniprot No.

Target Background

Database Links
Protein Families
MAL family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Myeloid-associated differentiation marker-like protein 2 (Myadml2) and what is its function in rats?

Myadml2 is a protein-coding gene that produces the myeloid-associated differentiation marker-like protein 2. While the complete functional characterization in rats is still evolving, it belongs to a family of proteins initially identified in myeloid cell differentiation pathways. The protein is encoded by the open reading frame (ORF) sequence represented in genomic databases. Current research suggests potential roles in cell differentiation processes, particularly in tissues where the protein shows significant expression patterns .

Key molecular characteristics include:

FeatureInformation
Gene SymbolMYADML2
Gene TypeProtein-coding
Sequence LengthApproximately 921bp (nucleotide)
Expression PatternTissue-specific (detailed mapping ongoing)

How does rat Myadml2 differ from its homologs in other mammalian species?

Comparative genomic analyses indicate that while Myadml2 maintains core structural domains across species, there are notable species-specific variations. Rat Myadml2 shares significant sequence homology with other rodent models but differs in certain regulatory elements that may influence tissue expression patterns. These differences highlight the importance of species-specific studies rather than generalizing findings across mammals .

When comparing rat models to other research organisms:

  • Rats offer physiological similarities to humans that make them valuable for translational research, potentially including Myadml2-related studies

  • Unlike mouse models, rat models provide a more comprehensive behavioral repertoire for phenotypic analysis

  • Regulatory elements controlling Myadml2 expression may differ between species, affecting tissue-specific expression patterns

What are the typical expression patterns of Myadml2 in different rat tissues?

While comprehensive tissue-specific expression maps for Myadml2 are still being established, research using transgenic models suggests that gene expression patterns are tightly regulated by tissue-specific promoter elements. Similar to other differentially expressed genes, Myadml2 likely maintains tissue autonomy even when experimentally manipulated . Gene expression studies in various rat strains indicate that tissue specificity is maintained even when genes are in close chromosomal proximity .

What are the optimal methods for producing recombinant rat Myadml2 protein?

Production of high-quality recombinant rat Myadml2 protein typically involves mammalian expression systems, particularly HEK293 cells, which provide proper post-translational modifications. Current protocols use tag systems such as His(Fc)-Avi tags to facilitate purification and detection .

Standard production methodology includes:

  • Gene synthesis or cloning of the rat Myadml2 ORF (921bp) into an appropriate expression vector such as pcDNA3.1

  • Transfection into HEK293 cells for protein expression

  • Purification using affinity chromatography targeted to the His or Fc portion of the tag

  • Quality control through SDS-PAGE to confirm purity (target ≥85%)

  • Storage as aliquots at -20°C to -80°C to avoid freeze-thaw cycles

How can researchers effectively measure Myadml2 expression levels in rat tissues?

Quantification of Myadml2 expression requires careful consideration of tissue-specific expression patterns. Based on studies of similar gene expression systems in rat models, effective methodologies include:

  • Quantitative RT-PCR using gene-specific primers designed to unique regions of Myadml2 mRNA

  • RNA-seq analysis for genome-wide expression profiling

  • Western blotting using antibodies against rat Myadml2 or its tagged recombinant forms

  • Immunohistochemistry for tissue localization studies

When designing experiments to measure expression patterns, researchers should consider the high degree of autonomy of control elements included in the cloned genomic DNA fragment, as demonstrated in transgenic studies of other genes . This approach helps ensure accurate identification of tissue-specific expression patterns.

What are the technical challenges in generating rat models with modified Myadml2 expression?

Creating transgenic or knockout rat models for Myadml2 studies presents several methodological challenges. Based on experience with similar genetic modifications in rats:

  • Selection of appropriate promoters is critical for tissue-specific expression

  • Integration site effects may influence transgene expression even with covalently linked genes

  • Verification of tissue specificity requires comprehensive testing across multiple tissues

  • Developmental timing of expression must be carefully monitored, as demonstrated by studies showing developmental regulation of transgene expression

Advanced strategies might include:

  • Chromosomal substitution strains (consomic) approach for studying Myadml2 in different genetic backgrounds

  • Recombinant inbred strains for mapping Myadml2-related phenotypes

  • Heterogeneous stock rats for studying Myadml2 variation in population-like genetic diversity

How can recombinant rat Myadml2 be utilized in disease model research?

Recombinant rat Myadml2 can serve as a valuable tool in various disease model studies. While specific applications of Myadml2 are still being developed, the paradigm of using rat models for translational research provides important guidance:

  • Functional studies using recombinant Myadml2 protein can help elucidate its role in normal cellular processes versus disease states

  • Tissue-specific expression studies can identify potential roles in organ-specific pathologies

  • Protein-interaction studies using tagged recombinant Myadml2 may reveal involvement in critical signaling pathways

The rat model offers particular advantages for studying complex physiological processes that may involve Myadml2, as rats display a larger behavioral repertoire compared to mice, facilitating more refined cognitive and physiological assessments .

What approaches should be used to identify Myadml2 interaction partners in rat tissues?

Identifying protein interaction networks is crucial for understanding Myadml2 function. Based on established methodologies for similar proteins:

  • Co-immunoprecipitation using anti-tag antibodies (for recombinant tagged Myadml2) or specific anti-Myadml2 antibodies

  • Proximity labeling techniques (BioID or APEX) fused to Myadml2 for in vivo interaction studies

  • Yeast two-hybrid screening using Myadml2 as bait

  • Mass spectrometry-based interactome analysis following pulldown experiments

When designing interaction studies, researchers should consider tissue-specific expression patterns, as demonstrated in transgenic studies showing that genes maintain their tissue specificity despite close proximity in the genome . This suggests potential tissue-specific interaction partners for Myadml2.

How does genetic background influence Myadml2 function in different rat strains?

Genetic background significantly impacts gene function and expression patterns in rat models. Research on other genes has shown that:

  • Different rat strains (such as SS/Dahl salt-sensitive and BN/Brown Norway) exhibit strain-specific phenotypic differences that can affect gene function

  • Chromosomal substitution strains allow mapping of genetic influences on Myadml2 expression or function

  • Recombinant inbred strains derived from crosses like SHR/Ola and BN-Lx/Cub provide valuable platforms for studying genetic influences on Myadml2

For comprehensive analysis:

  • Consider using heterogeneous stock rats that contain genetic material from eight diverse founder strains to study Myadml2 variation in a population-like setting

  • Map quantitative trait loci (QTLs) that affect Myadml2 expression or function using consomic or congenic strains

What are the best approaches for analyzing tissue-specific Myadml2 expression data?

Analysis of tissue-specific expression patterns requires sophisticated bioinformatic approaches. Based on studies of gene expression in transgenic rat models:

  • Normalization against appropriate housekeeping genes that are stable in the specific tissues under study

  • Consideration of developmental timing, as expression patterns may shift during development

  • Comparative analysis across multiple rat strains to distinguish strain-specific versus conserved expression patterns

  • Integration with genome-wide expression data to identify co-regulated genes

When interpreting results, researchers should consider that single chromosomal sites can be permissive for the proper expression of multiple genes with different tissue specificities, indicating autonomous control elements within the genomic fragment .

How should researchers address contradictory findings in Myadml2 functional studies?

Contradictory findings in functional studies are common challenges in molecular biology research. To address these specifically for Myadml2:

  • Carefully document experimental conditions, including:

    • Precise strain and genetic background information

    • Age and sex of animals

    • Tissue collection and processing methodologies

    • Expression system details for recombinant protein studies

  • Consider strain-specific effects, as demonstrated by studies showing that genetic background significantly influences gene expression and function

  • Evaluate tissue-specific differences in expression and function, as genes often maintain distinct tissue specificity despite close proximity in the genome

  • Utilize multiple complementary methodologies to validate findings, such as combining in vitro recombinant protein studies with in vivo transgenic models

How relevant are findings from rat Myadml2 studies to human health research?

Translational relevance of rat Myadml2 research to human applications requires careful consideration:

  • Rats are physiologically and genetically closer to humans than mice in many aspects, making them valuable translational models

  • Unlike mouse models, rats display six tau isoforms similar to humans (compared to three in mice), potentially making their cellular machinery more relevant for certain molecular studies

  • The larger behavioral repertoire of rats facilitates more refined assessments of physiological impacts that might relate to Myadml2 function

  • Gene regulation mechanisms may differ between rats and humans

  • Protein interaction networks may show species-specific variations

  • Functional redundancy in protein families may differ across species

What methodological considerations are important when comparing Myadml2 function across rat, mouse, and human systems?

Cross-species comparative studies require rigorous methodological approaches:

  • Sequence homology analysis to identify conserved domains versus species-specific regions

  • Equivalent expression systems (e.g., HEK293 cells) when producing recombinant proteins from different species

  • Standardized functional assays that can be applied consistently across species

  • Consideration of species-specific binding partners that may influence functionality

As demonstrated in transgenic studies, genes often maintain their tissue specificity autonomously , suggesting that comparing expression patterns across species requires examination of both the coding sequences and regulatory elements of Myadml2.

What emerging technologies might advance our understanding of rat Myadml2 function?

Several cutting-edge technologies hold promise for advancing Myadml2 research:

  • CRISPR/Cas9 gene editing for creating precise modifications to Myadml2 in rat models

  • Single-cell RNA sequencing to identify cell type-specific expression patterns within complex tissues

  • Spatial transcriptomics to map Myadml2 expression within tissue architecture

  • Proteomics approaches to identify post-translational modifications specific to Myadml2

  • Advanced imaging techniques for tracking Myadml2 localization and dynamics in living cells

The expanding genetic toolkit for rats, including germline competent embryonic stem cells and targeted gene manipulation technologies, will continue to improve the translational utility of rat models for Myadml2 research .

How might Myadml2 research contribute to understanding tissue-specific gene regulation mechanisms?

Myadml2 research offers opportunities to explore fundamental aspects of gene regulation:

  • Studies of tissue-specific expression patterns can illuminate how regulatory elements control gene expression autonomously

  • Comparison of Myadml2 regulation across rat strains can reveal genetic influences on tissue-specific expression

  • Analysis of Myadml2 expression during development may provide insights into developmental programming of gene expression

As demonstrated in transgenic studies, genes retain their tissue specificity despite close proximity in the genome, indicating a high degree of autonomy in gene regulation . The study of Myadml2 regulation may further enhance our understanding of these autonomous control mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.