Recombinant Rat N-acetylaspartate synthetase (Nat8l)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

The NAT8L gene encodes the Nat8l protein. The human NAT8L gene is located on chromosome 13q34 . Nat8l is expressed in various tissues, with high expression levels observed in the brain and adipose tissues . Within cells, Nat8l is found in the mitochondria of neuronal cells, where it contributes to the synthesis of NAA .

Function and Mechanism

Nat8l functions as an N-acetyltransferase, catalyzing the synthesis of NAA from acetyl-CoA and L-aspartate .

The primary reaction is:

$$ \text{Acetyl-CoA} + \text{L-Aspartate} \longrightarrow \text{NAA} + CoA $$

NAA, produced by Nat8l, plays multiple roles:

  • Myelination: NAA provides acetate for lipid synthesis in oligodendrocytes, which is essential for myelination in the brain .

  • Energy Metabolism: Nat8l is associated with the tricarboxylic acid cycle, influencing neuronal metabolism . It also impacts adipogenic marker gene expression, lipid turnover, and energy metabolism in brown adipocytes .

  • Neuronal Function: Nat8l affects neuronal function by influencing dopamine D1 receptor localization and modulating behavior .

Role in Disease

  1. Neurological Disorders:

    • Multiple Sclerosis: NAT8L mRNA oxidation is linked to neurodegeneration in multiple sclerosis .

    • Methamphetamine Dependence: NAT8L has an inhibitory effect on methamphetamine-induced hyperlocomotion and sensitization .

  2. Cancer:

    • Non-Small Cell Lung Cancer (NSCLC): NAT8L is overexpressed in NSCLC, leading to increased NAA production. NAA can be a potential biomarker for early lung cancer detection .

    • Hepatocellular Carcinoma: Hindering NAT8L expression in hepatocellular carcinoma increases .

  3. Metabolic Disorders:

    • Obesity: NAT8L accelerates lipid turnover and increases mitochondrial mass in adipocytes, suggesting it could be a target for modulating energy dissipation .

Research Findings

StudyFindings
Behavioral impairment in SHATI/NAT8L knockout mice via supplementation of acetate derived from NAA SHATI/NAT8L is involved in myelination in the juvenile mouse brain via supplementation of acetate derived from NAA. SHATI/NAT8L is associated with neurite elongation and the ATP synthetic pathway via NAA synthesis.
NAT8L (N-Acetyltransferase 8-Like) Accelerates Lipid Turnover and Energy Expenditure by Activating the PPARα/UCP1 Pathway in Brown Adipocytes Nat8l is highly expressed in adipose tissues and impacts adipogenic marker gene expression, lipid turnover, and energy metabolism in brown adipocytes. Overexpression of Nat8l in an immortalized brown adipogenic cell line influenced lipid turnover, increased mitochondrial mass, and accelerated energy expenditure, most likely by increasing the expression of UCP1 in a PPARα-dependent manner.
Cancer-specific production of N-acetylaspartate via NAT8L overexpression in non-small cell lung cancer and its potential as a circulating biomarker NAA is produced specifically in NSCLC tumors through NAT8L overexpression, and its extracellular secretion can be detected in blood. NAT8L is functionally involved in NAA production of NSCLC cells through siRNA-mediated suppression of NAT8L, which caused selective reduction of intracellular and secreted NAA.
Deletion of SHATI/NAT8L increases dopamine D1 receptor on the cell surface in the nucleus accumbens and enhances methamphetamine-induced behavioural changes NAT8L is associated with the AP-2 complex and regulates the localization of dopamine D1 receptor to the cell surface, resulting in an inhibitory effect on METH dependence. A SNP in the human NAT8L gene is related to the RD personality trait and caudate nucleus grey matter volume.
Brain Energy Homeostasis and the Regulation of N-acetyl-aspartate Metabolism: Implications for Canavan Disease Nat8l was up-regulated during a period of early postnatal development normally punctuated by low Nat8L expression and the transcriptional up-regulation of ASPA. ASPA is a possible negative regulator of Nat8L in response to energetic crisis, also predict the presence of signaling mechanisms involving cross talk between neurons and oligodendrocytes which control NAA metabolism during both postnatal development and neurodegenerative disease progression.
Discovery of small-molecule activators of nicotinamide phosphoribosyltransferase (NAMPT) and their preclinical neuroprotective activity The addition of NAT markedly increased the catalytic activity (V max) of NAMPT with higher Michaelis constants (K m) for both substrates, NAM, and PRPP.
NAT8L N-acetyltransferase 8 like [(human)] NAT8L mRNA oxidation is linked to neurodegeneration in multiple sclerosis. Hindering NAT8L expression in hepatocellular carcinoma increases.
Uncoupling N-acetylaspartate from brain pathology: implications for Canavan disease and the quest for a treatment Neuronal NAT8L overexpression results in elevated NAA levels but does not cause brain damage.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Nat8l; N-acetylaspartate synthetase; NAA synthetase; N-acetyltransferase 8-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Nat8l
Target Protein Sequence
MHCGPPDMVCETKIVATEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPPAAGPQP HGGTGGAGPPEGRGVCIREFRAAEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYAL LAALCFAVTRSLLLTCLVPAGLLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSC FWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRRVLEFAMLHNYSA VVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
Uniprot No.

Target Background

Function
Recombinant Rat N-acetylaspartate synthetase (Nat8l) plays a crucial role in lipogenesis regulation by producing N-acetylaspartate (NAA), a brain-specific metabolite. NAA is highly concentrated in the brain, and its hydrolysis is vital for maintaining white matter integrity. Furthermore, Nat8l promotes dopamine uptake by modulating TNF-alpha expression and attenuates methamphetamine-induced inhibition of dopamine uptake.
Gene References Into Functions
  1. Asp-NAT/NAT8L and NAA immunoreactivity show strong correlation in rat brains, primarily localized in neurons, including cortical pyramidal neurons and hippocampal granule cells. PMID: 20385109
Database Links
Protein Families
Camello family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein. Microsome membrane; Single-pass type I membrane protein. Mitochondrion membrane; Single-pass membrane protein. Rough endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in brain, including in mesencephalic dopaminergic neurons of the substantia nigra and ventral tegmental area and oligodendrocytes. Expressed in cortical pyramidal neurons and granule cells of the hippocampus (at protein level).

Q&A

What is Nat8l and what is its primary function?

Nat8l (N-acetyltransferase 8-like protein) is an enzyme that catalyzes the synthesis of N-acetylaspartate (NAA) from L-aspartate and acetyl-CoA. It is primarily found in neurons of the mammalian central nervous system and is essential for brain NAA production . The protein contains a conserved sequence characteristic of the GCN5 or NAT superfamily of N-acetyltransferases and functions as a single-pass membrane protein . Beyond its primary synthetic function, Nat8l promotes dopamine uptake by regulating TNF-alpha expression and attenuates methamphetamine-induced inhibition of dopamine uptake .

What is the structural organization of Nat8l protein?

Nat8l is a 302-residue protein with a characteristic N-acetyltransferase domain . Computational modeling studies have revealed its three-dimensional all-atom structure as a membrane-associated protein . The enzyme's active site accommodates both aspartate and acetyl coenzyme A cofactors within the protein molecule. The structure exhibits specific salt-bridge patterns, including Glu101-Arg220 interactions, which are likely important for its catalytic function . The lack of experimentally-derived three-dimensional structures has necessitated computational approaches, including contact map prediction, ab initio folding, homology modeling, and refinement techniques to elucidate its structure .

How can I effectively express and purify recombinant Nat8l protein?

For recombinant expression of Nat8l, several expression systems have been successfully employed. The wheat germ expression system has been documented for producing human Nat8l suitable for ELISA and Western blotting applications .

Methodology:

  • Clone the Nat8l cDNA into an appropriate expression vector containing a purification tag (His-tag or GST-tag)

  • Transform into the expression host (wheat germ extract for eukaryotic expression or E. coli for prokaryotic expression)

  • Induce protein expression under optimized conditions (temperature, inducer concentration, and duration)

  • Lyse cells using appropriate buffer systems containing protease inhibitors

  • Purify using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Confirm purity using SDS-PAGE (12.5% gels have been successfully employed)

  • Verify activity through enzymatic assays measuring NAA production

When expressing membrane-associated proteins like Nat8l, consider including detergents in your purification buffers to maintain protein solubility and structure.

What are the most effective methods for measuring Nat8l activity?

Nat8l activity can be measured by quantifying NAA production using several analytical techniques:

GC-MS Method:

  • Incubate purified recombinant Nat8l with L-aspartate and acetyl-CoA substrates in an appropriate buffer system

  • Stop the reaction with acidification

  • Extract NAA using liquid-liquid extraction

  • Derivatize samples for GC-MS analysis

  • Analyze using GC-MS with appropriate internal standards

  • Quantify NAA levels by comparison to standard curves

Alternative Methods:

  • HPLC with UV detection

  • LC-MS/MS for higher sensitivity

  • Magnetic resonance spectroscopy for in vivo or non-destructive analysis

For cellular models, siRNA-mediated suppression of NAT8L has been shown to cause selective reduction of both intracellular and secreted NAA, which can be used as a control to validate assay specificity .

How can I assess the expression levels of Nat8l in tissue samples?

Multiple approaches can be employed to assess Nat8l expression in tissue samples:

RNA-based methods:

  • RT-qPCR: Design primers specific to Nat8l mRNA sequence

  • RNA sequencing: For genome-wide analysis that includes Nat8l expression

  • In situ hybridization: For spatial localization of Nat8l mRNA in tissue sections

Protein-based methods:

  • Western blotting: Using validated antibodies against Nat8l

  • Immunohistochemistry: For spatial localization in tissue sections

  • Protein mass spectrometry: For unbiased detection and quantification

Expression pattern analysis:
Transcriptomic databases such as The Cancer Genome Atlas (TCGA) have been used to analyze Nat8l expression patterns across various tissues and disease states. For example, elevated NAT8L expression has been observed in approximately 40% of lung adenocarcinoma and squamous cell carcinoma cases, while expression remains minimal in non-malignant lung tissues .

What is the relationship between Nat8l activity and brain energy homeostasis?

Nat8l plays a significant role in brain energy homeostasis through its production of NAA:

  • Acetyl-CoA Allocation: Nat8l diverts acetyl-CoA from the TCA cycle for NAA synthesis, potentially affecting ATP production. Experimental evidence suggests that overexpressing Nat8l can decrease a cell's ability to produce ATP due to competition for the same intermediates .

  • Energy Crisis Response: Studies have shown that Nat8l expression changes during periods of energetic stress. During early stages of neurodegenerative diseases like Alzheimer's, changes in NAA levels may represent an active response to reduced energetic integrity .

  • Developmental Regulation: Nat8l expression is tightly regulated during postnatal development. In ASPA null (Nur7) mice, Nat8l was found to be up-regulated during early postnatal development, a period normally characterized by low Nat8l expression .

  • Neuronal-Oligodendrocyte Signaling: There appears to be signaling mechanisms involving cross-talk between neurons and oligodendrocytes that control NAA metabolism during both postnatal development and neurodegenerative disease progression .

The relationship between NAA synthesis and ATP production suggests that Nat8l activity must be precisely regulated to maintain brain energy homeostasis.

How does Nat8l expression affect dopaminergic transmission?

Nat8l has several documented effects on dopaminergic transmission:

  • Dopamine Uptake Regulation: Nat8l promotes dopamine uptake through regulation of TNF-alpha expression .

  • Protective Effect Against Methamphetamine: Nat8l attenuates methamphetamine-induced inhibition of dopamine uptake, suggesting a potential protective role in substance-related neuronal damage .

  • Metabolic Support: Through NAA production, Nat8l may indirectly support the metabolic needs of dopaminergic neurons and surrounding glial cells, maintaining the structural and functional integrity of dopaminergic circuits.

These findings suggest potential therapeutic applications targeting Nat8l in disorders affecting dopaminergic transmission, such as Parkinson's disease or substance use disorders.

What is the developmental expression pattern of Nat8l in the mammalian brain?

The developmental expression of Nat8l follows a specific pattern in the mammalian brain:

  • Early Postnatal Period: Normally characterized by low Nat8l expression .

  • Developmental Regulation: Nat8l expression is coordinated with ASPA (aspartoacylase, the enzyme that hydrolyzes NAA) transcriptional up-regulation during normal development .

  • Disease-Related Alterations: In ASPA null (Nur7) mice, Nat8l expression is up-regulated during early postnatal development, contrary to the normal pattern .

  • Regional Specificity: Expression patterns may vary across different brain regions, reflecting region-specific metabolic and developmental needs.

This tightly regulated developmental expression suggests critical roles for NAA metabolism in brain maturation, particularly in processes related to myelination and oligodendrocyte function.

What is known about Nat8l dysregulation in neurodegenerative diseases?

Nat8l dysregulation has been implicated in several neurodegenerative conditions:

  • Alzheimer's Disease: Studies using the 5xFAD model of Alzheimer's disease have shown altered transcriptional regulation of Nat8l during key periods of neurodegeneration. This suggests that changes in NAA metabolism may be an active response to reduced energetic integrity in early disease stages .

  • Canavan Disease: This leukodystrophy is characterized by NAA accumulation due to deficiency of ASPA, which breaks down NAA. While primarily an ASPA disorder, the continued production of NAA by Nat8l contributes to pathology, suggesting Nat8l inhibition as a potential therapeutic approach .

  • Primary NAA Deficiency: Mutations in the NAT8L gene can result in hypoacetylaspartia, characterized by absent or significantly reduced NAA levels in the brain .

  • Energy Metabolism Disorders: Given the relationship between NAA synthesis and energy metabolism, Nat8l dysregulation may contribute to or result from disorders affecting mitochondrial function and brain energy homeostasis.

Understanding these relationships may inform therapeutic approaches targeting NAA metabolism in neurodegenerative conditions.

What is the evidence for Nat8l/NAA involvement in cancer?

Recent evidence has revealed unexpected roles for Nat8l and NAA in cancer:

  • Cancer-Specific NAA Production: Global metabolite profiling has identified NAA as a unique metabolic compound in non-small cell lung cancer (NSCLC) cells that is undetectable in normal lung epithelium .

  • NAT8L Gene Expression in Cancer: Analysis of The Cancer Genome Atlas (TCGA) data revealed elevated NAT8L expression in approximately 40% of adenocarcinoma and squamous cell carcinoma cases (N=577), with minimal expression in non-malignant lung tissues (N=74) .

  • Functional Role: siRNA-mediated suppression of NAT8L caused selective reduction of intracellular and secreted NAA in NSCLC cells, confirming NAT8L's functional involvement in cancer-associated NAA production .

  • Glutamine Dependency: NAA biosynthesis in NSCLC cells depends on glutamine availability, linking it to cancer-associated metabolic reprogramming .

  • Biomarker Potential: Preliminary clinical evaluation showed elevated NAA blood levels in 46% of NSCLC patients compared to age-matched healthy controls among individuals aged 55 years or younger .

These findings suggest that Nat8l-produced NAA may serve as both a cancer biomarker and potentially a therapeutic target.

What mutations in the NAT8L gene are associated with clinical phenotypes?

The NAT8L gene contains several mutations with clinical significance:

  • Primary NAA Deficiency: Mutations in NAT8L can result in hypoacetylaspartia, characterized by absent or significantly reduced NAA levels .

  • Clinical Database Records: According to ClinVar data, there are multiple mutations in NAT8L that have been classified based on their clinical and pathological significance .

  • Post-Translational Modification Sites: NAT8L contains PTM sites that may be affected by mutations, potentially altering enzyme function or regulation .

  • Total Documented Mutations: At least 27 mutations have been identified in NAT8L .

Further research is needed to fully characterize the functional consequences of these mutations and their relationship to specific clinical phenotypes.

What are the current limitations in Nat8l structural studies and how might they be overcome?

Current limitations in Nat8l structural studies include:

  • Lack of Experimental Structures: No experimentally derived three-dimensional structures of NAT8L currently exist, posing obstacles to understanding the mechanism of NAA formation and its role in neurological disorders .

  • Membrane Association Challenges: As a membrane-associated protein, Nat8l presents technical challenges for structural biology methods like X-ray crystallography.

  • Computational Model Validation: While computational models have been developed, their accuracy requires validation through experimental approaches .

Potential Solutions:

  • Cryo-EM Approaches: Single-particle cryo-electron microscopy could overcome some limitations of crystallography for membrane proteins.

  • Advanced Computational Methods: Continued refinement of contact map prediction, ab initio folding, and homology modeling techniques .

  • Hybrid Approaches: Combining computational predictions with limited experimental data from techniques like hydrogen-deuterium exchange mass spectrometry or cross-linking mass spectrometry.

  • Structure-Function Studies: Site-directed mutagenesis based on computational models to validate important structural features and refine models.

How might the metabolic relationship between Nat8l/NAA and energy homeostasis be therapeutically targeted?

The metabolic relationship between Nat8l/NAA and energy homeostasis presents several potential therapeutic targeting strategies:

  • Modulating Nat8l Activity in Neurodegeneration:

    • In conditions with NAA accumulation (e.g., Canavan disease), Nat8l inhibition might reduce pathological NAA levels

    • In conditions with reduced NAA (e.g., some neurodegenerative diseases), boosting Nat8l activity might restore beneficial NAA functions

  • Cancer Metabolism Targeting:

    • Given Nat8l's role in cancer-specific NAA production and its dependence on glutamine, dual targeting of glutamine metabolism and Nat8l might synergistically affect cancer cells

    • Nat8l inhibition could potentially disrupt cancer-specific metabolic adaptations

  • Drug Development Approaches:

    • Small molecule inhibitors designed based on the modeled structure of Nat8l's active site

    • Allosteric modulators that target regulatory sites rather than the catalytic center

    • RNA-based therapeutics to modulate Nat8l expression levels

  • Precision Medicine Applications:

    • Stratification of patients based on NAA levels or Nat8l expression for targeted interventions

    • Combination therapies targeting both Nat8l and interacting metabolic pathways

These approaches would require careful consideration of tissue specificity and potential off-target effects given NAA's important physiological roles in the nervous system.

What experimental models are most appropriate for studying Nat8l function in different research contexts?

Different research contexts require specific experimental models for studying Nat8l function:

Table 1: Experimental Models for Nat8l Research

Research ContextRecommended ModelsAdvantagesLimitations
Biochemical CharacterizationRecombinant protein expressed in wheat germ or E. coli systems Pure protein for enzymatic studies; Amenable to structure-function analysesMay lack post-translational modifications; Membrane association challenges
Cellular FunctionHEK293 cells with exogenous Nat8l expression ; NSCLC cell lines with endogenous Nat8l expression Well-characterized systems; Easily manipulated geneticallyMay not reflect tissue-specific regulation; Artificial expression levels
Developmental StudiesNur7 mice (ASPA-null) ; Wild-type rodent developmental seriesNatural developmental progression; Disease-relevant for Canavan diseaseSpecies differences; Complex in vivo regulation
Neurodegenerative Disease5xFAD mouse model (Alzheimer's) Well-established AD model; Shows Nat8l regulation changesMay not fully recapitulate human disease; Multiple pathological processes
Cancer BiologyNSCLC cell lines; Patient-derived xenografts Direct disease relevance; Captures cancer heterogeneityVariability between cell lines and patients; Complex tumor microenvironment effects
Clinical TranslationHuman biospecimens; Blood NAA assays Direct clinical relevance; Non-invasive biomarker potentialLimited access to tissues; Multiple confounding factors

When selecting an experimental model, researchers should consider:

  • The specific research question being addressed

  • Required level of biological complexity

  • Availability of genetic manipulation tools

  • Translational relevance

  • Technical feasibility and available resources

What are the best practices for quantifying NAA levels in experimental samples?

Accurate quantification of NAA levels requires careful attention to methodology:

  • Sample Preparation:

    • Rapid tissue processing to prevent degradation

    • Standardized extraction procedures for consistency

    • Inclusion of appropriate internal standards

    • Consideration of matrix effects

  • Analytical Methods:

    • GC-MS: Offers good sensitivity and specificity for NAA quantification

    • HPLC: Provides good separation but may have lower sensitivity

    • Nuclear Magnetic Resonance (NMR) spectroscopy: Non-destructive but requires larger sample amounts

    • Magnetic Resonance Spectroscopy (MRS): For in vivo measurements

  • Calibration and Validation:

    • Use of purified NAA standards for calibration curves

    • Quality control samples at low, medium, and high concentrations

    • Matrix-matched calibrators when possible

    • Assessment of method linearity, precision, accuracy, and limits of detection/quantification

  • Data Analysis:

    • Normalization strategies (per mg protein, per g tissue, etc.)

    • Statistical approaches appropriate for data distribution

    • Consideration of biological variability

    • Correlation with other metabolic markers

For clinical applications, standardized protocols with established reference ranges are essential for meaningful interpretation of results.

How can researchers resolve contradictory findings about Nat8l function across different experimental models?

Resolving contradictory findings about Nat8l function requires systematic approaches:

  • Standardization of Methods:

    • Establish consensus protocols for measuring Nat8l expression and activity

    • Use multiple complementary methods to validate findings

    • Report detailed methodology to enable replication

  • Model-Specific Considerations:

    • Document species differences in Nat8l sequence, expression, and regulation

    • Consider developmental stage, as Nat8l expression changes during development

    • Account for disease state or pathological conditions that may alter normal function

  • Contextual Factors:

    • Assess energy state and metabolic conditions, as Nat8l function is linked to energy homeostasis

    • Consider glutamine availability, which affects NAA biosynthesis

    • Evaluate cell/tissue type, as Nat8l may function differently across neural cell populations

  • Integrated Analysis Approaches:

    • Combine multiple data types (genomic, transcriptomic, proteomic, metabolomic)

    • Use computational modeling to predict context-dependent functions

    • Conduct meta-analyses across multiple studies

  • Collaborative Validation:

    • Establish research consortia to validate key findings across laboratories

    • Develop shared resources and standardized reagents

    • Implement open science practices for data sharing

By systematically addressing these factors, researchers can develop a more nuanced understanding of Nat8l function across different experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.