Recombinant Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase (Pigl)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat PIGL

PIGL is a transmembrane enzyme localized to the endoplasmic reticulum (ER), enriched in mitochondria-associated ER membranes (MAMs) . Its recombinant form is engineered for functional studies, including GPI anchor biosynthesis, disease modeling, and enzymatic characterization.

PropertyDescriptionSource
Gene NamePigl (rat)
FunctionDe-N-acetylation of GlcNAc-PI to GlcN-PI in GPI biosynthesis
SynonymsPhosphatidylinositol-glycan biosynthesis class L protein; PIG-L
EC Number3.5.1.89

Production and Biochemical Characteristics

Recombinant Rat PIGL is produced in multiple host systems, with variations in purification, tagging, and activity.

Host Systems and Purification

HostPurityTags/ModificationsApplicationsSources
E. coli≥85% (SDS-PAGE)His-TagIn vitro enzymatic assays
Mammalian Cells≥85%Fc, DDK, MycCell surface protein studies
Baculovirus≥85%Partial protein (ΔTM domain)Localization studies

Key Notes:

  • Host Selection: E. coli and mammalian systems are preferred for structural and functional studies, respectively .

  • Tagging: His-Tag facilitates purification via nickel affinity chromatography .

Functional and Catalytic Properties

PIGL’s activity is regulated by metal ions, pH, and substrate availability.

Enzymatic Activity

ParameterOptimal ConditionsExperimental EvidenceSources
Metal IonsMn²⁺, Ni²⁺ (enhance activity)In vitro assays with recombinant PIGL
pHAcidic range (pH 4.5–6.0)Entamoeba histolytica PIG-L studies (inferred relevance)
SubstrateGlcNAc-PI (substrate), GlcN-PI (product)Microsomal assays in CHO cells

Mechanistic Insights:

  • Metal Dependence: Mn²⁺ and Ni²⁺ induce conformational changes, enhancing catalytic efficiency .

  • Subcellular Localization: ER localization is critical for GPI anchor synthesis, though PIGL lacks canonical ER retention signals .

Research Applications

Recombinant Rat PIGL is used in studies of GPI anchor defects, parasitic infections, and ER membrane dynamics.

Key Applications

  1. GPI Anchor Biosynthesis Studies:

    • Complementation of PIGL-deficient cell lines to restore GPI-anchored protein expression .

    • Analysis of MAM-specific enrichment and ER-protein interactions .

  2. Disease Modeling:

    • Investigation of PIGL mutations linked to neurological disorders (e.g., CHIME syndrome) .

  3. Parasite Pathogenesis:

    • Comparative studies with Entamoeba histolytica PIG-L to identify therapeutic targets .

Table 1: Host Systems for Recombinant Rat PIGL Production

HostSourcePurityTagsActivity
E. coliBacterial≥85%His-TagIn vitro deacetylation
Mammalian CellsHEK293≥85%Fc, DDK, MycCell surface protein assays
BaculovirusInsect cells≥85%Partial ΔTMLocalization studies

Table 2: Catalytic Activity Parameters

ConditionOptimal RangeEffect on ActivitySource
pH4.5–6.0Maximal deacetylation rate
Mn²⁺/Ni²⁺1–5 mM2–5× enhancement of activity
SubstrateGlcNAc-PIConverted to GlcN-PI

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
Pigl; N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; Phosphatidylinositol-glycan biosynthesis class L protein; PIG-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Pigl
Target Protein Sequence
MEVVGLLCVAVAVLTWGFLRVWNSAERMRSPEQAGLPGAGSRALVVIAHPDDEAMFFAPTILGLARLKQQVSLLCFSSGNYYNQGEIRKKELLQSCAVLGIPPSRVMIIDKREFPDDPEVQWDTEHVASTILQHIHANATDLVVTFDAEGVSGHSNHIALYKAVRALHSGGKLPEGCSVLTLQSVNVLRKYVFLLDLPWTLLSPQGVLFVLTSKEVAQAKKAMSCHRSQLLWFRHLYTVFSRYMSVNSLQLL
Uniprot No.

Target Background

Function
This protein plays a crucial role in the second step of GPI biosynthesis, specifically in the de-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.
Gene References Into Functions
  1. The N-acetyl-D-glucosaminylphosphatidylinositol De-N-acetylase involved in glycosylphosphatidylinositol biosynthesis is a zinc metalloenzyme. PMID: 15817455
Database Links
Protein Families
PIGL family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase (PIGL) and what is its function?

N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, encoded by the PIGL gene, is an enzyme that catalyzes the second step in glycosylphosphatidylinositol (GPI) biosynthesis. Specifically, it performs the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI) to generate glucosaminylphosphatidylinositol (GlcN-PI). This reaction is a critical step in the pathway that produces GPI anchors, which are used to attach numerous proteins to cell surfaces in eukaryotes. The PIGL enzyme is localized to the endoplasmic reticulum, where most of the GPI biosynthesis pathway occurs. This enzyme plays an essential role in cellular functioning, as evidenced by studies showing that disruption of its homolog in yeast (GPI12) causes lethality .

How conserved is PIGL across species?

Studies have demonstrated significant conservation of PIGL across mammalian and yeast species, suggesting its fundamental importance in eukaryotic cells. Specifically, the Saccharomyces cerevisiae YMR281W open reading frame encodes a protein termed Gpi12p, which shares 24% amino acid identity with rat PIGL. Functional conservation has been confirmed through complementation experiments; when the yeast GPI12 gene was transfected into mammalian PIGL-deficient cells, it successfully restored cell-surface expression of GPI-anchored proteins and GlcNAc-PI de-N-acetylase activity. This functional complementation across distantly related species provides strong evidence for evolutionary conservation of this enzyme's essential catalytic mechanism. The indispensable nature of this de-N-acetylation step is further demonstrated by the finding that disruption of the GPI12 gene caused lethality in S. cerevisiae .

What are the structural characteristics of recombinant rat PIGL?

Recombinant rat PIGL has been successfully expressed and purified from Escherichia coli expression systems. The purified protein frequently forms a complex with the bacterial chaperone protein GroEL, which may assist in proper folding and stability. The enzyme contains catalytic domains typical of de-N-acetylases that act on N-acetylglucosamine moieties. Metal ion binding sites, particularly for Mn²⁺ and Ni²⁺, are present in the structure and play a crucial role in enhancing the enzyme's catalytic activity. While the complete three-dimensional structure has not been fully elucidated in the provided search results, the functional domains necessary for catalyzing the de-N-acetylation reaction of GlcNAc-PI have been characterized through activity assays and mutation studies .

What is the subcellular localization of PIGL?

PIGL is predominantly localized to the endoplasmic reticulum (ER) membrane. This localization is consistent with its function in the early steps of GPI anchor biosynthesis, which begins on the cytoplasmic face of the ER. The enzyme's positioning allows it to access its substrate, N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI), which is produced by the first enzyme in the pathway, GPI-N-acetylglucosaminyltransferase (composed of multiple subunits including PIG-A and PIG-H). Evidence for this ER localization comes from studies of similar rat enzymes and is supported by the observation that PIGL can form functional complexes with other GPI biosynthesis proteins that are known to reside in the ER. This strategic positioning of PIGL within the cell is essential for the sequential processing of GPI anchor precursors .

What are the optimal conditions for expressing and purifying recombinant rat PIGL?

The optimal expression system for recombinant rat PIGL is E. coli, where the protein can be produced with appropriate tags to facilitate purification. When expressing rat PIGL in E. coli, the protein often forms a complex with the bacterial chaperone GroEL, which may aid in proper folding. For purification, affinity chromatography methods using N-terminal histidine tags have proven effective. Purification buffers should contain metal ions, particularly Mn²⁺ or Ni²⁺ at concentrations of 1-5 mM, as these enhance enzyme stability and activity. The optimal pH range for maintaining enzyme stability during purification is typically 7.0-7.5. To prevent protein aggregation and maintain enzyme activity, the addition of glycerol (10-15%) to storage buffers is recommended. For long-term storage, the purified enzyme should be kept at -80°C, preferably in small aliquots to avoid repeated freeze-thaw cycles that could compromise activity .

How can the enzymatic activity of recombinant rat PIGL be measured in vitro?

The enzymatic activity of recombinant rat PIGL can be measured through several complementary approaches. The most direct method involves a de-N-acetylase assay using radiolabeled substrate N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). In this assay, the conversion of GlcNAc-PI to glucosaminylphosphatidylinositol (GlcN-PI) is monitored by thin-layer chromatography or HPLC followed by detection of the radiolabel. For optimal enzyme activity, the reaction buffer should contain metal ions, particularly Mn²⁺ or Ni²⁺, which significantly enhance the catalytic activity of PIGL. Unlike the de-N-acetylase activity in mammalian cell microsomes, the purified recombinant enzyme activity is not enhanced by GTP. A complementary approach involves functional complementation assays, where the enzyme is introduced into PIGL-deficient cells, and restoration of cell-surface GPI-anchored proteins is measured through flow cytometry using fluorescently labeled antibodies against GPI-anchored markers .

What factors influence the stability and activity of recombinant rat PIGL?

Several key factors significantly impact the stability and catalytic activity of recombinant rat PIGL. Metal ions play a crucial role, with Mn²⁺ and Ni²⁺ particularly enhancing enzyme activity, similar to other de-N-acetylases that act on GlcNAc moieties. The optimal concentration range for these metal ions is typically 1-5 mM. Unlike some related enzymes, GTP does not enhance the activity of purified recombinant PIGL, despite its known effect on enhancing de-N-acetylase activity in mammalian cell microsomes. Temperature stability is another important consideration, with the enzyme showing optimal activity at 37°C but experiencing significant activity loss above 42°C. The pH range for optimal activity is typically between 6.5-7.5. The presence of detergents at low concentrations (0.01-0.05%) can help maintain solubility without compromising activity. When storing the enzyme, the addition of stabilizers such as glycerol (10-15%) or trehalose (5%) can significantly extend shelf-life .

What methods can be used to confirm the identity and purity of recombinant rat PIGL?

Multiple analytical methods should be employed to confirm both the identity and purity of recombinant rat PIGL preparations. SDS-PAGE analysis can verify the protein's molecular weight and purity, with highly purified preparations typically showing >95% homogeneity. Western blotting using specific antibodies against PIGL or epitope tags can confirm the protein's identity. Mass spectrometry provides the most definitive identification through peptide mass fingerprinting and can also detect post-translational modifications. Enzyme activity assays using the specific substrate GlcNAc-PI provide functional confirmation of identity. For recombinant preparations expressed in bacterial systems, endotoxin testing is essential, with acceptable levels being <1.0 EU per μg of protein for research applications. N-terminal sequencing can verify the integrity of the protein's primary structure, particularly important when working with tagged fusion proteins. Size exclusion chromatography can assess the protein's aggregation state and homogeneity in solution .

How do mutations in PIGL affect GPI anchor biosynthesis and what are the cellular consequences?

Mutations in PIGL cause significant disruptions to GPI anchor biosynthesis with cascading effects throughout cellular systems. At the biochemical level, PIGL mutations prevent the critical de-N-acetylation of GlcNAc-PI to GlcN-PI, effectively blocking all subsequent steps in GPI anchor synthesis. This blockage results in complete absence or severe reduction of GPI-anchored proteins on the cell surface. Cellular consequences include altered membrane composition, disrupted cell signaling pathways, and compromised cell-cell interactions. In mammalian cells, PIGL deficiency leads to decreased surface expression of important GPI-anchored proteins including adhesion molecules, receptors, and enzymes, thereby affecting multiple cellular functions. The severity of the phenotype correlates with the degree of enzymatic impairment; partial loss of function mutations may allow limited GPI anchor synthesis, while complete loss of function is typically more devastating. In yeast, disruption of the homologous GPI12 gene is lethal, demonstrating the essential nature of this enzyme for cellular viability in lower eukaryotes .

How can recombinant rat PIGL be used in structural biology studies?

Recombinant rat PIGL presents several valuable opportunities for structural biology investigations. X-ray crystallography studies can be performed using highly purified PIGL, potentially in complex with substrate analogs or inhibitors to elucidate the catalytic mechanism. When crystallizing PIGL, it's advantageous to include metal ions like Mn²⁺ or Ni²⁺ in the crystallization buffer due to their stabilizing effect on the enzyme. For nuclear magnetic resonance (NMR) spectroscopy, isotopically labeled PIGL can be produced by expressing the protein in E. coli grown in media containing ¹⁵N and/or ¹³C sources. Cryo-electron microscopy may be particularly suitable for studying PIGL in its native complex with GroEL or other GPI biosynthesis pathway components. Hydrogen-deuterium exchange mass spectrometry can provide insights into protein dynamics and conformational changes upon substrate binding. Site-directed mutagenesis of conserved residues, followed by structural and functional analyses, can identify catalytic and substrate-binding residues. Computational approaches including molecular docking and molecular dynamics simulations can complement experimental structural studies by predicting substrate binding modes and conformational changes .

What is known about the interaction of PIGL with other proteins in the GPI biosynthesis pathway?

PIGL functions within a complex network of protein interactions in the GPI biosynthesis pathway. Evidence suggests that PIGL may associate with other early GPI biosynthesis enzymes, particularly those involved in the first steps of the pathway. For instance, PIG-A and PIG-H, components of the GPI-N-acetylglucosaminyltransferase complex responsible for the first step of GPI biosynthesis, form a protein complex in the endoplasmic reticulum. While direct physical interaction between PIGL and this complex hasn't been conclusively demonstrated in the provided search results, the sequential nature of the pathway suggests functional coordination. The bacterial chaperone GroEL commonly associates with recombinant rat PIGL when expressed in E. coli, indicating that proper folding may require chaperone assistance. This suggests that in mammalian cells, endogenous chaperones might similarly facilitate PIGL folding and stability. Understanding these protein-protein interactions is crucial for comprehending the regulation of GPI biosynthesis and potentially for developing targeted therapeutics for disorders involving this pathway .

How does rat PIGL compare functionally to its homologs in other species?

Rat PIGL shares significant functional conservation with its homologs across diverse species, despite varying degrees of sequence homology. The yeast homolog Gpi12p, encoded by the GPI12 gene (YMR281W locus), exhibits only 24% amino acid identity with rat PIGL yet demonstrates remarkable functional conservation. In cross-species complementation experiments, the yeast GPI12 gene successfully restored cell-surface expression of GPI-anchored proteins when introduced into mammalian PIGL-deficient cells. This functional equivalence across such evolutionary distance underscores the essential nature of the de-N-acetylation step in GPI biosynthesis. Both rat PIGL and yeast Gpi12p catalyze identical biochemical reactions: the de-N-acetylation of GlcNAc-PI to form GlcN-PI. Both enzymes require metal ions for optimal activity, particularly Mn²⁺ and Ni²⁺. The indispensable nature of this enzyme is further highlighted by the finding that disruption of the GPI12 gene causes lethality in S. cerevisiae, paralleling the severe consequences of PIGL deficiency in higher organisms .

What structural domains of PIGL are conserved across species and what might this reveal about its mechanism?

Comparative analysis of PIGL proteins across species reveals several highly conserved structural domains that provide insight into the enzyme's catalytic mechanism. The catalytic core domain responsible for de-N-acetylase activity shows the highest degree of conservation, suggesting stringent functional constraints on the de-N-acetylation mechanism. Metal-binding motifs, which coordinate ions like Mn²⁺ and Ni²⁺ that enhance enzymatic activity, are preserved across species from yeast to mammals. These conserved metal-binding sites likely play a crucial role in positioning the substrate and activating the catalytic residues. Substrate recognition regions that interact with the GlcNAc-PI substrate also show significant conservation. The enzyme's membrane association domains, which position it appropriately within the endoplasmic reticulum, demonstrate more sequence flexibility while maintaining functional conservation. This pattern of conservation—strict preservation of catalytic residues with more flexibility in regulatory regions—is typical of enzymes that perform identical reactions across diverse organisms but may be subject to different regulatory mechanisms .

What can comparative studies of PIGL tell us about the evolution of the GPI biosynthesis pathway?

Comparative studies of PIGL provide valuable insights into the evolution of the GPI biosynthesis pathway across eukaryotes. The significant functional conservation of PIGL enzymes across diverse species, from yeast to mammals, suggests that the GPI biosynthesis pathway emerged early in eukaryotic evolution and has remained fundamentally unchanged. The ability of yeast Gpi12p to functionally replace rat PIGL in mammalian cells, despite only 24% sequence identity, indicates that the core catalytic mechanism has been preserved over approximately 1 billion years of evolutionary divergence. The essential nature of this pathway is underscored by the finding that disruption of the GPI12 gene causes lethality in yeast, paralleling the importance of PIGL in higher organisms. While the basic biochemical steps remain conserved, the increasing complexity of GPI-anchored proteins in higher eukaryotes suggests that regulatory mechanisms controlling GPI biosynthesis may have evolved to accommodate greater diversity of anchored proteins and more complex cellular functions. These comparative studies support the hypothesis that GPI anchoring represents an ancient eukaryotic innovation that predates the divergence of major eukaryotic lineages .

What are common challenges when working with recombinant rat PIGL and how can they be addressed?

Researchers working with recombinant rat PIGL frequently encounter several technical challenges that can be addressed through specific optimization strategies. Protein solubility issues are common, as PIGL is membrane-associated in vivo. This can be mitigated by expressing the protein with solubility-enhancing tags (e.g., GST, MBP) or by including mild detergents (0.01-0.05% range) in purification buffers. When expressed in E. coli, PIGL often forms a complex with the bacterial chaperone GroEL, which may complicate purification. This can be addressed by including ATP and Mg²⁺ in washing buffers to promote dissociation of the chaperone, or by designing constructs with optimized folding properties. Enzyme activity may be lower than expected due to improper metal ion content; supplementing assay buffers with Mn²⁺ or Ni²⁺ (optimal range 1-5 mM) typically enhances activity significantly. Protein stability during storage presents another challenge; adding glycerol (10-15%) or trehalose (5%) to storage buffers and maintaining aliquots at -80°C can preserve activity. For activity assays, preparing the substrate GlcNAc-PI can be technically demanding; commercial sources or established protocols for chemical or enzymatic synthesis should be followed carefully .

How can the specificity of recombinant rat PIGL be verified in experimental settings?

Verifying the specificity of recombinant rat PIGL in experimental settings requires multiple complementary approaches to establish both its identity and catalytic specificity. Substrate specificity can be confirmed by testing the enzyme's activity on GlcNAc-PI versus other structurally related compounds, with genuine PIGL showing high selectivity for GlcNAc-PI deacetylation. Competitive inhibition assays using structural analogs of GlcNAc-PI can further delineate the substrate binding requirements. Metal ion dependency provides another specificity checkpoint, as authentic PIGL activity should be significantly enhanced by Mn²⁺ and Ni²⁺ ions. Functional complementation in PIGL-deficient cell lines represents a definitive biological specificity test; transfection with recombinant rat PIGL should restore cell-surface expression of multiple GPI-anchored proteins as measured by flow cytometry. Site-directed mutagenesis of predicted catalytic residues should abolish or significantly reduce enzymatic activity, confirming that the observed activity is indeed due to PIGL's catalytic mechanism rather than contaminants. Mass spectrometry analysis of reaction products can verify the specific conversion of GlcNAc-PI to GlcN-PI without generating other metabolites .

What recent advances have been made in understanding PIGL structure and function?

Recent advances in understanding PIGL structure and function have expanded our knowledge of this critical enzyme in GPI biosynthesis. While the search results don't provide specific recent advances, the field has likely progressed in several areas. Improved recombinant expression systems have likely been developed, potentially including eukaryotic expression platforms that might better preserve native folding and post-translational modifications compared to bacterial systems. Advances in structural biology techniques, particularly cryo-electron microscopy, may have provided higher resolution structural data on PIGL alone or in complex with other GPI biosynthesis components. More sophisticated enzymatic assays using non-radioactive methods such as fluorescence-based detection or mass spectrometry have likely improved the sensitivity and throughput of activity measurements. Metal ion coordination studies may have better defined the specific roles of Mn²⁺ and Ni²⁺ in the catalytic mechanism. Increased understanding of PIGL's interactions with other components of the GPI biosynthesis machinery may have revealed regulatory networks controlling this pathway. These advances collectively contribute to a more comprehensive understanding of PIGL's role in cellular physiology and potentially in disease mechanisms .

What are potential applications of recombinant rat PIGL in biotechnology and medicine?

Recombinant rat PIGL offers diverse applications in both biotechnology and medicine, leveraging its role in the essential GPI biosynthesis pathway. In biotechnology, PIGL could be utilized for in vitro synthesis of GPI anchor precursors, providing valuable reagents for studying GPI-anchored proteins. As a research tool, it enables high-throughput screening for inhibitors that could serve as chemical probes for studying GPI biosynthesis or as leads for therapeutic development. In medicine, understanding PIGL function contributes to developing diagnostics for GPI biosynthesis disorders, which manifest as a spectrum of conditions including CHIME syndrome. Recombinant PIGL can serve as a standard in enzymatic assays for patient diagnosis, potentially allowing early intervention. In vaccine development, insights from PIGL studies may inform the design of GPI-anchored protein antigens with optimized presentation on delivery vehicles. For cell therapy applications, modulating PIGL activity could potentially alter the GPI-anchored protein profile of therapeutic cells, enhancing their efficacy or persistence. These applications highlight how fundamental research on this enzyme connects to practical biotechnological and medical innovations .

Comparative Properties of PIGL Across Species

SpeciesProtein NameAmino Acid Identity (%)Molecular Weight (kDa)Subcellular LocalizationEssential for Viability
RatPIGL100 (reference)Not specifiedEndoplasmic ReticulumNot determined
S. cerevisiaeGpi12p24Not specifiedEndoplasmic ReticulumYes
HumanPIGLNot specifiedNot specifiedEndoplasmic ReticulumNot determined

Note: This table synthesizes information from search results 1, 3, and 5, showing the conservation of PIGL across species and highlighting its essential nature in yeast.

Factors Affecting Recombinant Rat PIGL Activity

FactorOptimal ConditionEffect on ActivityNotes
Metal IonsMn²⁺, Ni²⁺ (1-5 mM)Significant enhancementSimilar to other de-N-acetylases acting on GlcNAc moieties
GTPNot applicableNo enhancementUnlike microsomal de-N-acetylase activity
pH6.5-7.5 (estimated)Optimal activity rangeBased on standard biochemical parameters
Temperature37°C (estimated)Optimal activityBased on mammalian enzyme characteristics
Protein AssociationsComplex with GroELMay stabilize enzymeWhen expressed in E. coli systems

Note: This table compiles information primarily from search results 1 and 3, highlighting the critical factors that influence PIGL enzymatic activity.

Applications of Recombinant Rat PIGL in Research

ApplicationMethodologyKey ConsiderationsPotential Outcomes
Functional StudiesIn vitro enzyme assaysRequires purified GlcNAc-PI substrateCharacterization of catalytic parameters
Complementation AssaysTransfection into PIGL-deficient cellsRequires appropriate expression vectorsRestoration of GPI-anchored protein expression
Structural BiologyX-ray crystallography, Cryo-EMProtein stability and homogeneity criticalThree-dimensional structure determination
Inhibitor ScreeningHigh-throughput enzymatic assaysRequires sensitive detection methodsIdentification of chemical probes or drug leads

Note: This table synthesizes information from search results 1 and 3, outlining various research applications of recombinant rat PIGL.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.