Recombinant Rat N-acetyltransferase 8 (Nat8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Nat8; Cml4; N-acetyltransferase 8; Acetyltransferase 2; ATase2; Camello-like protein 4; Cysteinyl-conjugate N-acetyltransferase; CCNAT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Nat8
Target Protein Sequence
MASFHIRQFQERDYEQVVDMFSRGMKEHIPTAFRHLLLLPRTLLLLLGVPLALVLVSGSW LLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGGQIVG TVGALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLVTGLL QQGAVTLYYSMGFQKTGESFMDILTWLVDVSLIHFIYPLPSS
Uniprot No.

Target Background

Function

Recombinant Rat N-acetyltransferase 8 (Nat8) acetylates the free alpha-amino group of cysteine S-conjugates to form mercapturic acids. This is the final step in a major detoxification pathway for various reactive electrophiles. This pathway begins with the incorporation of electrophiles into glutathione S-conjugates, which are then processed into cysteine S-conjugates and finally mercapturic acids. These mercapturic acids are water-soluble and readily excreted in urine or bile. Nat8 may also exhibit lysine N-acetyltransferase activity, catalyzing peptidyl-lysine N6-acetylation of proteins. This activity may regulate apoptosis through acetylation and modulation of PROM1 expression. Furthermore, Nat8 may regulate amyloid beta-peptide secretion by acetylating BACE1 and regulating its expression in neurons.

Database Links

KEGG: rno:64570

UniGene: Rn.204804

Protein Families
Camello family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane; Single-pass type II membrane protein.

Q&A

What is the function of rat N-acetyltransferase 8 (Nat8)?

Rat N-acetyltransferase 8 (Nat8) is an enzyme involved in the mercapturic acid (MA) pathway, which processes glutathione conjugates. Nat8 catalyzes the transfer of an acetyl group from acetyl-CoA to the cysteine amino group of cysteine conjugates, producing N-acetylcysteine conjugates (mercapturic acids) that are excreted in urine . This acetylation step is critical for the detoxification and elimination of various xenobiotics and their metabolites from the body. Understanding this function is essential for researchers investigating xenobiotic metabolism, detoxification mechanisms, and comparative biochemistry across species.

What expression systems are suitable for producing recombinant rat Nat8?

For producing recombinant rat Nat8, researchers have successfully used bacterial expression systems such as Escherichia coli, similar to other N-acetyltransferases. For example, genes for rat cytosolic acetyltransferases have been cloned and expressed in E. coli with preserved enzymatic activity . Mammalian expression systems such as HEK293T cells have also proven effective for expressing human NAT8 . When selecting an expression system, consider:

  • Bacterial systems (E. coli): Advantages include high yield and cost-effectiveness but may lack post-translational modifications

  • Mammalian systems (HEK293T): Provide proper folding and post-translational modifications but with lower yield

  • Insect cell systems (Sf9, High Five): Offer a compromise between yield and proper protein processing

The choice should be guided by your specific research requirements, particularly whether post-translational modifications are essential for your study.

How can I assess the enzymatic activity of recombinant rat Nat8?

Assessment of recombinant rat Nat8 enzymatic activity can be performed using several methods:

  • HPLC-MS method: Develop a high-performance liquid chromatography-mass spectrometry method for quantitation of S-aryl-substituted cysteine conjugates and their mercapturic acids . This approach allows precise measurement of substrate-to-product conversion.

  • Spectrophotometric assays: Monitor the decrease in acetyl-CoA or the formation of mercapturic acids spectrophotometrically.

  • Visual decolorization test: For initial screening of active clones, a visual test can be employed, similar to the method used for other N-acetyltransferases where decolorization of 4-aminoazobenzene in bacterial medium indicates acetylation activity .

For kinetic characterization, measure the activity at varying substrate concentrations to determine kinetic parameters such as Km and Vmax using Michaelis-Menten kinetics analysis.

How does rat Nat8 compare with other mammalian N-acetyltransferases in terms of substrate specificity?

The substrate specificity of rat Nat8 can be compared with other N-acetyltransferases through systematic kinetic analysis. Based on studies of related N-acetyltransferases, there are several important considerations:

N-acetyltransferasePreferred SubstratesApproximate Km ValuesSpecies
Rat NAT1Arylhydroxamic acids0.2-0.9 μM (2-AF, AAB)Rat
Rat NAT2Aromatic amines22-32 μM (2-AF), 62-138 μM (AAB)Rat
Human NAT8S-aryl cysteine conjugatesSimilar Km values for benzyl-, 4-nitrobenzyl-, and 1-menaphthylcysteineHuman

For rat Nat8 specifically, you would need to test its activity with various S-aryl-substituted cysteine conjugates including benzylcysteine, 4-nitrobenzylcysteine, and 1-menaphthylcysteine . The relative activity and affinity for these substrates can reveal its unique substrate preference profile compared to other N-acetyltransferases. When conducting such comparative studies, ensure standardized experimental conditions (pH, temperature, cofactor concentrations) to make valid comparisons across different enzymes.

What role might Nat8 play in cellular bioenergetics and lipid metabolism?

While specific evidence for rat Nat8's role in bioenergetics is limited, insights can be drawn from the related family member NAT8L. Studies show that NAT8L is highly expressed in adipose tissues and influences lipid turnover and energy metabolism, particularly in brown adipocytes . Based on this parallel, researchers investigating rat Nat8 should consider:

  • Examining Nat8 expression levels in different metabolic tissues (liver, adipose, kidney)

  • Investigating potential interactions between Nat8 and metabolic pathways involving acetyl-CoA utilization

  • Exploring Nat8's impact on cellular bioenergetics through:

    • Oxygen consumption rate measurements

    • Mitochondrial function assessments

    • Lipid turnover analysis

To investigate these connections experimentally, consider knockdown/overexpression studies of Nat8 in relevant cell lines followed by comprehensive metabolic profiling. Stable isotope labeling with acetate/aspartate could help track the metabolic fate of Nat8 substrates in cellular pathways . These approaches would help elucidate whether Nat8, like NAT8L, participates in metabolic regulation beyond its established detoxification role.

What are the optimal conditions for expressing and purifying recombinant rat Nat8?

For optimal expression and purification of recombinant rat Nat8, consider the following protocol based on successful approaches with related N-acetyltransferases:

Expression System Selection:

  • E. coli BL21(DE3) for high yield

  • HEK293T cells for mammalian expression with proper folding and post-translational modifications

Expression Optimization:

  • For bacterial expression:

    • Use a pET vector system with T7 promoter

    • Optimize induction conditions: IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and duration (4-24 hours)

    • Lower induction temperatures (16-25°C) often improve solubility

  • For mammalian expression:

    • Consider using a CMV promoter-driven vector

    • Optimize transfection methods (calcium phosphate, lipofection, or PEI)

    • Harvest cells 48-72 hours post-transfection

Purification Strategy:

  • Add an affinity tag (His6, GST, or FLAG) to facilitate purification

  • Use a two-step purification process:

    • First step: Affinity chromatography (Ni-NTA for His-tagged protein)

    • Second step: Size exclusion chromatography or ion exchange chromatography

  • Buffer optimization:

    • Try different pH ranges (7.0-8.0)

    • Include stabilizing agents (5-10% glycerol, 1-5 mM DTT or β-mercaptoethanol)

    • Test the addition of cofactors (0.1-1.0 mM acetyl-CoA) for stability

Activity Verification:

  • Develop an HPLC-MS method for quantitation of enzyme activity

  • Perform activity assays with known substrates to confirm functionality

Monitoring expression at multiple time points and testing different lysis conditions will help maximize yield of functional protein.

What analytical methods are most suitable for characterizing the kinetics of rat Nat8?

For comprehensive kinetic characterization of rat Nat8, several complementary analytical methods should be considered:

  • HPLC-MS Analysis:

    • Develop an HPLC-MS method for direct quantification of substrates and products

    • Advantage: High sensitivity and specificity for complex mixtures

    • Application: Determine conversion rates of various cysteine conjugates to their N-acetylated products

  • Spectrophotometric Assays:

    • Monitor the decrease in acetyl-CoA using coupling enzymes or direct absorbance

    • Advantage: Real-time monitoring of reaction progress

    • Application: High-throughput screening of reaction conditions

  • Radioactive Substrate Assays:

    • Use labeled substrates (e.g., 14C-labeled aspartate for NAT8L studies)

    • Advantage: High sensitivity for low activity detection

    • Application: Particularly useful for inhibitor screening and competition studies

For kinetic parameter determination:

  • Measure initial velocities at varying substrate concentrations (typically 0.1-10× Km)

  • Plot velocity versus substrate concentration and fit to appropriate enzyme kinetic models (Michaelis-Menten, allosteric, etc.)

  • Determine key parameters: Km, Vmax, kcat, and catalytic efficiency (kcat/Km)

For inhibition studies:

  • Use competitive, uncompetitive, and mixed inhibitors to probe binding mechanisms

  • Perform Dixon plots or Lineweaver-Burk analyses to determine inhibition constants (Ki)

Remember to maintain consistent reaction conditions (pH, temperature, ionic strength) throughout all experiments for valid comparisons and reproducible results.

How can I design inhibitor screening assays for rat Nat8?

Designing effective inhibitor screening assays for rat Nat8 requires careful consideration of assay format, detection methods, and validation steps. Based on approaches used for similar enzymes, I recommend the following comprehensive strategy:

Primary Screening Assay (Fluorescence-based):

  • Assay development:

    • Determine linear range for time (up to 30 min) and protein concentration

    • Establish Km values for key substrates (cysteine conjugates and acetyl-CoA)

    • Optimize buffer conditions, pH, temperature, and cofactor concentrations

  • Screening conditions:

    • Use substrate concentrations at or slightly below Km values

    • Select appropriate positive controls (known inhibitors) and negative controls

    • Include DMSO controls to account for solvent effects

  • Data analysis:

    • Calculate percent inhibition relative to controls

    • Establish hit criteria (typically >50% inhibition at 10 μM)

    • Perform dose-response studies on initial hits

Secondary Confirmation Assay (Orthogonal Radioactive-based):

  • Use radiolabeled substrates (e.g., 14C-labeled cysteine conjugates)

  • Confirm activity of hits from primary screen

  • Eliminate false positives due to assay interference

Mechanism of Inhibition Studies:

  • Perform kinetic analyses varying both substrate and inhibitor concentrations

  • Determine inhibition type (competitive, uncompetitive, noncompetitive, or mixed)

  • Calculate inhibition constants (Ki)

This approach mirrors successful inhibitor discovery cascades for related enzymes, such as the aspartate N-acetyltransferase (ANAT) screening where both fluorescence-based and radioactive orthogonal assays were employed to identify compounds with dose-dependent inhibition . By using multiple assay formats, you can increase confidence in your hits and gain valuable insights into their mechanism of action.

How should I interpret differences in substrate specificity between recombinant rat Nat8 and other N-acetyltransferases?

When analyzing substrate specificity differences between recombinant rat Nat8 and other N-acetyltransferases, consider the following analytical framework:

  • Kinetic Parameter Comparison:

    • Compare Km values across enzymes for the same substrates

    • Lower Km values (e.g., 0.2-0.9 μM for rat NAT1 vs. 22-32 μM for rat NAT2) indicate higher affinity

    • Examine catalytic efficiency (kcat/Km) as the most comprehensive measure of substrate preference

  • Structural Basis Analysis:

    • Relate differences in substrate specificity to structural variations in the substrate binding pocket

    • Consider creating homology models based on crystal structures of related enzymes

    • Perform molecular docking studies to visualize substrate-enzyme interactions

  • Physiological Context Interpretation:

    • At low substrate concentrations (<5 μM), enzymes with lower Km values (like NAT1) would predominantly catalyze reactions in vivo

    • Consider tissue-specific expression patterns when interpreting the physiological relevance of in vitro findings

    • Remember that kinetic parameters measured in vitro may differ from actual in vivo activity due to compartmentalization, cofactor availability, and regulatory mechanisms

  • Evolutionary Perspective:

    • Analyze conservation of key catalytic residues across species

    • Consider how substrate specificity differences might reflect adaptive specialization

For presentation of your results, create comprehensive tables showing kinetic parameters for multiple substrates across different N-acetyltransferases, and use radar plots to visually represent substrate preference profiles. This multi-faceted approach will provide deeper insights into the functional specialization of rat Nat8 within the broader N-acetyltransferase family.

What factors might contribute to variability in enzymatic activity measurements of recombinant rat Nat8?

Several factors can contribute to variability in enzymatic activity measurements of recombinant rat Nat8. Understanding and controlling these variables is crucial for generating reproducible and reliable data:

  • Protein Quality Factors:

    • Expression system variations (bacterial vs. mammalian)

    • Protein folding heterogeneity

    • Post-translational modifications

    • Storage conditions and freeze-thaw cycles

    • Batch-to-batch variation in purification

  • Assay Condition Variables:

    • Buffer composition (pH, ionic strength)

    • Temperature fluctuations during assay

    • Presence of inhibitory contaminants

    • Substrate purity and stability

    • Acetyl-CoA quality and degradation

  • Analytical Method Considerations:

    • Detection limit variations between methods (HPLC-MS vs. spectrophotometric)

    • Matrix effects in complex samples

    • Instrument calibration and drift

    • Signal-to-noise ratio differences

  • Data Analysis Issues:

    • Different kinetic models applied to the same data

    • Inconsistent selection of initial velocity ranges

    • Variation in background subtraction methods

To minimize these sources of variability:

  • Implement rigorous quality control for recombinant protein (SDS-PAGE, Western blot, mass spectrometry)

  • Include standard reference materials in each assay batch

  • Perform technical and biological replicates

  • Use statistical methods like ANOVA to identify significant sources of variation

  • Calculate and report coefficient of variation (CV) values for all measurements

How can I effectively compare data on rat Nat8 with published literature on human NAT8 to draw translational insights?

Effective comparison between rat Nat8 and human NAT8 data requires a structured approach to ensure valid translational insights:

  • Standardized Parameter Comparison:

    • Create normalized comparison tables of kinetic parameters (Km, kcat, kcat/Km)

    • When direct comparisons aren't possible, calculate relative activity ratios using a common reference substrate

    • Example data organization:

    ParameterRat Nat8Human NAT8Fold DifferenceReference
    Km for Substrate Xx μMy μMy/x[citation]
    kcat for Substrate Xa s⁻¹b s⁻¹b/a[citation]
    Substrate preference ratio (X/Y)mnn/m[citation]
  • Sequence and Structure Analysis:

    • Perform sequence alignment to identify conserved and divergent regions

    • Calculate sequence identity percentage in catalytic domains

    • Use homology modeling to visualize structural differences in substrate binding sites

    • Correlate sequence/structural differences with functional disparities

  • Experimental Condition Reconciliation:

    • Adjust for differences in experimental conditions (pH, temperature, buffer)

    • Consider repeating key experiments under identical conditions for direct comparison

    • Use purified enzymes from both species in parallel assays

  • Physiological Context Integration:

    • Compare tissue expression patterns between species

    • Examine species differences in relevant metabolic pathways

    • Consider differences in xenobiotic metabolism between rats and humans

  • Translational Implications Assessment:

    • Evaluate how identified differences might affect extrapolation of rat studies to humans

    • Assess implications for drug metabolism, toxicology, and pharmacokinetics

    • Consider developing correction factors for interspecies extrapolation

When publishing your findings, clearly acknowledge methodological differences between studies and discuss potential confounding factors. Visualize key comparisons using radar charts or heat maps to highlight patterns of similarity and difference across multiple parameters, which can make translational insights more accessible to readers.

What strategies can address low expression or poor solubility of recombinant rat Nat8?

When facing challenges with low expression or poor solubility of recombinant rat Nat8, consider implementing the following systematic troubleshooting approaches:

For Low Expression:

  • Vector optimization:

    • Test different promoter strengths (T7, tac, CMV)

    • Optimize codon usage for expression host

    • Verify plasmid stability and sequence integrity

  • Expression conditions:

    • Screen multiple expression strains (BL21(DE3), Rosetta, ArticExpress)

    • Perform temperature optimization (16°C, 25°C, 30°C, 37°C)

    • Test various induction protocols (IPTG concentration, induction time)

    • Consider auto-induction media for gradual protein expression

  • Expression monitoring:

    • Use small-scale test expressions with different conditions

    • Monitor protein levels by SDS-PAGE and Western blot

    • Verify mRNA expression levels by RT-qPCR

For Poor Solubility:

  • Fusion tags:

    • Test solubility-enhancing tags (MBP, SUMO, Thioredoxin)

    • Position tags at N- or C-terminus to determine optimal configuration

    • Include appropriate linkers between tag and protein

  • Buffer optimization:

    • Screen different pH ranges (6.5-8.5)

    • Test various salt concentrations (100-500 mM NaCl)

    • Add stabilizing agents:

      • Glycerol (5-20%)

      • Reducing agents (1-5 mM DTT or β-mercaptoethanol)

      • Mild detergents (0.05-0.1% Triton X-100, NP-40)

      • Substrate or substrate analogs

  • Solubilization strategies:

    • Gentle cell lysis methods (sonication optimization)

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Consider on-column refolding for proteins recovered from inclusion bodies

Case-specific approach:
For N-acetyltransferases specifically, adding acetyl-CoA (0.1-1.0 mM) to lysis and purification buffers may stabilize the enzyme. Additionally, maintaining NAT8 with its substrates has shown improved stability in previous studies with related enzymes . If other approaches fail, consider expressing the protein in mammalian cells like HEK293T, which have successfully been used for human NAT8 expression .

Document all optimization steps systematically to identify the critical parameters affecting expression and solubility for your specific construct.

How can I address inconsistent kinetic data when analyzing rat Nat8 activity?

  • Ensure Enzyme Quality and Stability:

    • Verify enzyme purity by SDS-PAGE (>95% purity is recommended)

    • Check for enzyme degradation during storage or assay

    • Determine optimal storage conditions (temperature, buffer composition)

    • Establish a specific activity benchmark for quality control

    • Aliquot enzyme preparations to avoid freeze-thaw cycles

  • Optimize Assay Conditions:

    • Establish linear range for both time and enzyme concentration:

      • Verify that reaction velocity remains constant for at least 30 minutes

      • Confirm linearity with protein concentration up to ~100 ng/μL

    • Control temperature fluctuations (±0.5°C) during reactions

    • Maintain consistent mixing and reaction initiation methods

    • Minimize batch effects by preparing master mixes

  • Substrate Considerations:

    • Verify substrate purity and stability

    • For hydrophobic substrates, ensure consistent solubilization

    • Prepare fresh acetyl-CoA solutions for each experiment

    • Account for potential substrate inhibition at high concentrations

  • Data Analysis Refinement:

    • Apply appropriate kinetic models:

      • Standard Michaelis-Menten for simple kinetics

      • Hill equation for cooperative behavior

      • Models accounting for substrate inhibition when present

    • Use weighted non-linear regression for heteroscedastic data

    • Perform statistical outlier detection

    • Calculate 95% confidence intervals for all kinetic parameters

  • Technical and Experimental Design:

    • Include internal standards in HPLC-MS based assays

    • Run technical triplicates for each experimental condition

    • Perform independent biological replicates (different protein preparations)

    • Include positive controls (known substrates) in each assay

  • Advanced Troubleshooting:

    • Test for product inhibition by adding known amounts of product

    • Examine time-dependent changes in enzyme activity

    • Investigate buffer component interactions

    • Consider enzyme microheterogeneity affecting subpopulation kinetics

By implementing these measures, you can significantly improve data consistency and confidence in your kinetic parameters, leading to more reliable characterization of rat Nat8 enzymatic properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.