Recombinant Rat NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (Ndufa11)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
Ndufa11; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11; Complex I-B14.7; CI-B14.7; NADH-ubiquinone oxidoreductase subunit B14.7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAKRFFEAYNETPDGTQCHRKAYITTALGGLCGLISSAYSITHNPADSPLEAVARVGRFT
FTAAAIGAMFGLTTCVSAQVREKPDDPLNYFIGGCAGGLTLGARTHSYGTAAIGCVYMGT
AAALFKMGKLEGWELFATPKV
Uniprot No.
Target Background
Function
Recombinant Rat NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (Ndufa11) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be catalytically active. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone thought to be the immediate electron acceptor.
Database Links
Protein Families
Complex I NDUFA11 subunit family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
