Recombinant Rat NADH-ubiquinone oxidoreductase chain 3 (Mtnd3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please note it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mtnd3; mt-Nd3; Nd3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mtnd3
Target Protein Sequence
MNLPIIITINITLSFILISIAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQTTNTTTMMATAFILVTILSLGLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), Mtnd3 catalyzes electron transfer from NADH through the respiratory chain, employing ubiquinone as an electron acceptor. It is essential for the catalytic activity of complex I.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of NADH-ubiquinone oxidoreductase chain 3 (Mtnd3) in mitochondrial function?

NADH-ubiquinone oxidoreductase chain 3 (Mtnd3) is a critical subunit of Complex I, the first enzyme in the mitochondrial respiratory chain. Complex I catalyzes the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane. This process establishes the electrochemical gradient required for ATP synthesis via oxidative phosphorylation. Mtnd3 specifically plays a structural and functional role in stabilizing the electron transfer pathway and maintaining the integrity of Complex I assembly. Mutations or deficiencies in Mtnd3 can disrupt Complex I activity, leading to impaired ATP production and increased reactive oxygen species (ROS), which are implicated in mitochondrial diseases such as Leigh syndrome .

How can recombinant rat Mtnd3 be expressed and purified for functional studies?

Recombinant expression of rat Mtnd3 typically involves cloning the Mtnd3 gene into an expression vector suitable for bacterial, yeast, or mammalian cell systems. Codon optimization is often employed to enhance translation efficiency in heterologous systems. For mitochondrial targeting, the inclusion of a mitochondrial targeting sequence (MTS) upstream of Mtnd3 is essential. Following expression, purification protocols may involve affinity chromatography using tags such as His or FLAG.

What experimental models are available for studying Mtnd3-related mitochondrial dysfunction?

Several experimental models have been developed to investigate Mtnd3-related dysfunctions:

  • Cellular Models: Mitochondrial DNA (mtDNA) editing techniques, such as DddA-derived cytosine base editors, have been used to introduce specific mutations into mtDNA encoding Mtnd3. These models allow researchers to study the effects of pathogenic variants on mitochondrial function .

  • Animal Models: Conditional knockout (cKO) rats with tissue-specific depletion of Mtnd3 have been generated to study its role in cardiac and neurological functions. For example, depletion of Mtnd3 in rat hearts leads to impaired cardiac function and abnormal mitochondrial structure .

  • Patient-Derived Models: Fibroblasts or induced pluripotent stem cells (iPSCs) from patients harboring Mtnd3 mutations can be used to explore disease mechanisms and test therapeutic interventions .

These models provide insights into the pathophysiology of mitochondrial diseases and facilitate preclinical testing of potential therapies.

How can researchers evaluate the functional impact of Mtnd3 mutations?

Functional evaluation of Mtnd3 mutations involves several approaches:

  • Complex I Activity Assays: Measure NADH-dependent ubiquinone reduction rates using spectrophotometric or fluorometric methods.

  • ATP Production Assays: Quantify ATP synthesis rates under oxidative phosphorylation conditions.

  • Mitochondrial Respiration Analysis: Use high-resolution respirometry to assess oxygen consumption rates (OCR) in isolated mitochondria or intact cells.

  • Protein Stability and Assembly: Western blotting and blue native PAGE can be used to evaluate the stability of Mtnd3 and its incorporation into Complex I.

  • Mitochondrial ROS Measurement: Assess ROS levels using fluorescent probes such as MitoSOX.

  • Genetic Approaches: Complementation studies with wild-type Mtnd3 can confirm causality of specific mutations .

These methods collectively provide a comprehensive understanding of how mutations affect mitochondrial function.

What are the challenges associated with delivering therapeutic mRNA encoding Mtnd3 into mitochondria?

Therapeutic delivery of mRNA encoding Mtnd3 faces several technical challenges:

  • Mitochondrial Targeting: Unlike nuclear-encoded genes, mtDNA-encoded genes like Mtnd3 lack standard transcriptional machinery in the cytoplasm. Researchers have addressed this by modifying mRNA with a start codon compatible with mitochondrial translation systems .

  • Intracellular Trafficking: Efficient delivery systems such as MITO-Porters are required to transport mRNA across cellular membranes and target mitochondria specifically .

  • Translation Efficiency: Polyadenylation and codon optimization are critical for ensuring efficient translation within mitochondria.

  • Stability and Degradation: Exogenous mRNA must resist degradation by cellular RNases while maintaining functionality upon delivery.

Despite these challenges, recent studies have demonstrated partial restoration of Complex I activity using codon-optimized Mtnd3 mRNA delivered into mitochondria, highlighting its therapeutic potential .

How does heteroplasmy influence studies involving mtDNA-encoded genes like Mtnd3?

Heteroplasmy refers to the coexistence of wild-type and mutant mtDNA within a single cell or organism. This phenomenon complicates studies on mtDNA-encoded genes like Mtnd3 because the functional impact depends on the proportion of mutant mtDNA:

  • Threshold Effect: A critical threshold level of mutant mtDNA must be exceeded before functional impairments manifest.

  • Tissue-Specific Variability: Different tissues exhibit varying tolerances to heteroplasmy due to their metabolic demands.

To address these complexities, researchers use techniques such as single-cell sequencing or digital PCR to quantify heteroplasmy levels accurately. Additionally, models with controlled heteroplasmy levels provide valuable insights into genotype-phenotype correlations .

What are the implications of epigenetic modifications on Mtnd3 expression and function?

Epigenetic modifications, including DNA methylation and histone acetylation, can influence mtDNA-encoded gene expression indirectly through nuclear-mitochondrial crosstalk:

  • Methylation Patterns: Although mtDNA lacks histones, methylation at CpG sites within regulatory regions can affect transcriptional activity.

  • Nuclear Regulation: Nuclear-encoded factors that regulate mtDNA replication and transcription may themselves be epigenetically modified.

Recent studies suggest that environmental factors such as oxidative stress can alter epigenetic marks, thereby modulating Mtnd3 expression and mitochondrial function . Understanding these interactions is crucial for developing epigenetic therapies targeting mitochondrial diseases.

How can population genetics inform studies on Mtnd3?

Population genetic analyses provide insights into evolutionary pressures acting on mtDNA-encoded genes like Mtnd3:

  • Polymorphism Studies: Variants in the regulatory regions of mtDNA can affect gene expression and contribute to population-specific adaptations .

  • Positive Selection: Certain variants may confer advantages under specific environmental conditions, such as increased oxidative stress tolerance .

By integrating population genetics with functional assays, researchers can identify clinically relevant variants and understand their contributions to disease susceptibility across different populations.

What are the latest advances in correcting pathogenic variants in mtDNA encoding Mtnd3?

Recent advances in genome editing have enabled precise correction of pathogenic variants in mtDNA:

  • Base Editing: Tools like DddA-derived cytosine base editors facilitate targeted conversion of C·G-to-T·A base pairs without introducing double-strand breaks .

  • Mitochondrial Gene Replacement: Codon optimization allows nuclear expression of mtDNA-encoded genes followed by import into mitochondria using targeting sequences .

These technologies hold promise for treating mitochondrial diseases caused by Mtnd3 mutations but require further refinement to improve efficiency and specificity while minimizing off-target effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.