Recombinant Rat NADH-ubiquinone oxidoreductase chain 4L (Mtnd4l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Mtnd4l; mt-Nd4l; Nd4l; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mtnd4l
Target Protein Sequence
MTSAFLNLTMAFTLSLLGTFMFRSHLMSTLLCLEGMMLSLFVMTSTSTLNSNSMISMTIP ITILVFAACEAAVGLALLVKISNTHGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 4L (Mtnd4l) and what is its role in cellular function?

NADH-ubiquinone oxidoreductase chain 4L (Mtnd4l) is a mitochondrially encoded protein that forms an essential component of Complex I (NADH dehydrogenase) in the electron transport chain. This relatively small protein (approximately 10.741 kDa) is embedded in the inner mitochondrial membrane as a multi-pass membrane protein . Functionally, it participates in the first step of the electron transport process, which involves the transfer of electrons from NADH to ubiquinone (coenzyme Q). This electron transfer is a critical initial step in oxidative phosphorylation, which generates the electrochemical gradient necessary for ATP production . The immediate electron acceptor for the enzyme is believed to be ubiquinone, although the precise mechanism of electron transfer specifically involving the ND4L subunit requires further characterization .

What are the methodological considerations for expressing recombinant Mtnd4l in experimental systems?

Expressing recombinant Mtnd4l presents unique challenges due to its mitochondrial origin and hydrophobic nature. Researchers should consider the following methodological approaches:

  • Expression system selection: Bacterial expression systems often struggle with mitochondrial proteins. Eukaryotic systems like yeast, insect cells, or mammalian cells may better accommodate the post-translational modifications and membrane integration required.

  • Codon optimization: Since mitochondrial DNA uses a slightly different genetic code than nuclear DNA, codon optimization is essential when expressing Mtnd4l from a nuclear plasmid in most expression systems.

  • Fusion tags: Addition of solubility-enhancing tags (e.g., MBP, SUMO) or purification tags (His, GST) can improve expression and purification, though care must be taken to ensure these don't interfere with structure or function.

  • Membrane mimetics: Since Mtnd4l is a membrane protein, incorporation into nanodiscs, liposomes, or detergent micelles is often necessary to maintain native conformation.

  • Verification methods: Western blotting with validated anti-Mtnd4l antibodies , mass spectrometry, and functional assays measuring electron transfer capability are essential to confirm successful expression.

Why is Mtnd4l particularly challenging to study using knockout approaches?

Unlike other mitochondrial proteins, Mtnd4l presents unique challenges for knockout studies. As demonstrated in conditional knockout rat resource studies, while 12 other mitochondrial proteins could be depleted or nearly depleted in C6 cells, ND4L could not be targeted due to its lack of swappable codons . This technical limitation stems from the compact nature of the mitochondrial genome, where Mtnd4l's sequence lacks appropriate sites for the application of conventional gene editing techniques like DdCBE (DddA-derived cytosine base editors).

This challenge necessitates alternative approaches for studying Mtnd4l function, such as:

  • Point mutation studies rather than complete knockouts

  • RNA interference approaches targeting the transcript

  • Inhibitor-based studies of Complex I with downstream analysis of effects on specific subunits

  • Heterologous expression systems to study variant forms

The unique genetic characteristics of Mtnd4l highlight the need for more sophisticated tools to study mitochondrial genes with similar constraints.

What is the evidence linking Mtnd4l mutations to neurological disorders?

Substantial evidence links mutations in MT-ND4L to neurological disorders, particularly:

Leber Hereditary Optic Neuropathy (LHON): A specific mutation in MT-ND4L (T10663C or Val65Ala) has been identified in several families with LHON . This mutation changes the valine amino acid to alanine at position 65 in the protein sequence. Current research suggests this mutation disrupts the normal activity of Complex I in the mitochondrial inner membrane, potentially leading to:

  • Reduced ATP production

  • Increased reactive oxygen species generation

  • Altered cellular respiration in retinal ganglion cells

  • Compromised axonal transport in the optic nerve

Alzheimer's Disease (AD): Recent whole exome sequencing analysis from the Alzheimer's Disease Sequencing Project identified a study-wide significant association between AD and:

These findings provide compelling evidence for mitochondrial dysfunction, particularly involving Complex I and specifically the ND4L subunit, in the pathogenesis of neurodegenerative diseases.

How do Mtnd4l variants impact mitochondrial function in model systems?

Mtnd4l variants can impact mitochondrial function through several mechanisms, with effects that cascade from the molecular to cellular levels:

Level of ImpactNormal FunctionEffect of Pathogenic Variants
Complex I AssemblyND4L integrates properly into Complex IImpaired assembly of functional Complex I
Electron TransportEfficient electron transfer from NADH to ubiquinoneDecreased electron transfer efficiency
Proton PumpingNormal proton gradient generationReduced proton gradient across inner membrane
ATP ProductionOptimal ATP synthesis via ATP synthaseDecreased ATP production
ROS GenerationControlled ROS levelsIncreased oxidative stress from excess ROS
Mitochondrial DynamicsNormal fission/fusion balanceAltered mitochondrial network and morphology

In rat models, although direct ND4L depletion has been challenging due to the lack of swappable codons , studies of other Complex I components have demonstrated that disruption of this complex leads to severe physiological consequences. For example, conditional knockout of other Complex I components (ND1, ND2, ND5) in rats resulted in impaired cardiac function, abnormal brain development, and early mortality , suggesting that similar consequences would likely occur with Mtnd4l disruption.

What are the optimal methods for studying Mtnd4l protein-protein interactions within Complex I?

Studying Mtnd4l protein-protein interactions within Complex I requires specialized approaches due to its membrane localization and integration within a large multi-subunit complex:

  • Proximity Labeling Techniques:

    • BioID or TurboID fusion constructs to identify proteins in close proximity to Mtnd4l

    • APEX2-based proximity labeling for electron microscopy visualization

    • These methods are particularly useful as they can capture transient or weak interactions

  • Crosslinking Mass Spectrometry (XL-MS):

    • Chemical crosslinking of closely associated proteins followed by mass spectrometry

    • Identification of specific amino acid residues involved in subunit interactions

    • Data analysis using specialized software to map interaction interfaces

  • Cryo-Electron Microscopy:

    • High-resolution structural studies of intact Complex I

    • Mapping the position of Mtnd4l within the larger complex

    • Analysis of conformational changes during electron transport

  • Co-Immunoprecipitation with Specific Antibodies:

    • Using validated Mtnd4l antibodies to pull down the protein and its interacting partners

    • Western blot or mass spectrometry analysis of co-precipitated proteins

    • Comparison between normal and mutant forms to identify altered interactions

  • Split Reporter Protein Complementation Assays:

    • Modified assays using membrane-compatible reporter proteins

    • Testing specific hypothesized interaction partners

    • Quantitative measurement of interaction strengths

When designing these experiments, it's crucial to maintain the membrane environment or use appropriate membrane mimetics to preserve native interactions that would be disrupted in solution.

What are the considerations for generating and validating antibodies against recombinant rat Mtnd4l?

Generating and validating antibodies against recombinant rat Mtnd4l requires careful consideration of the protein's unique characteristics:

  • Epitope Selection:

    • Analysis of hydrophilicity, surface accessibility, and antigenicity profiles

    • Selection of regions that differ from other Complex I subunits to prevent cross-reactivity

    • Consideration of species conservation if cross-reactivity with human MT-ND4L is desired

  • Immunization Strategies:

    • Use of recombinant protein fragments for hydrophilic regions

    • Synthetic peptides for targeting specific epitopes

    • KLH or other carrier proteins for enhancing immunogenicity

  • Antibody Validation Methods:

    • Western blotting against mitochondrial fractions from rat tissues

    • Immunoprecipitation followed by mass spectrometry confirmation

    • Immunohistochemistry with appropriate positive and negative controls

    • Testing on tissues known to express Mtnd4l positively and negatively

    • Validation in knockout/knockdown models if available

  • Specificity Testing:

    • Cross-reactivity testing against other Complex I subunits

    • Pre-absorption controls with immunizing peptides

    • Reactivity testing in multiple rat tissue types with varying Mtnd4l expression levels

  • Application Optimization:

    • Determination of optimal working conditions for each application (WB, IP, IHC, etc.)

    • Testing fixation sensitivity for immunohistochemistry applications

    • Establishing detection limits for quantitative applications

Commercial antibody providers validate their MT-ND4L antibodies by testing them on tissues known to express the protein positively and negatively , which is a crucial step in ensuring antibody specificity before experimental use.

How can recombinant Mtnd4l be utilized to study mitochondrial dysfunction in neurodegenerative diseases?

Recombinant Mtnd4l offers several advanced applications for investigating mitochondrial dysfunction in neurodegenerative conditions:

  • Disease Variant Modeling:

    • Generation of recombinant Mtnd4l proteins containing disease-associated mutations (e.g., the T10663C/Val65Ala LHON mutation or the rs28709356 AD-associated variant)

    • Incorporation into liposomes or nanodiscs for functional studies

    • Comparative analysis of electron transfer efficiency between wild-type and mutant forms

  • Interaction Perturbation Analysis:

    • Identification of altered protein-protein interactions caused by disease variants

    • Screening compounds that can restore normal interactions or compensate for dysfunction

    • Mapping interaction interfaces that are disrupted in pathological states

  • Biomarker Development:

    • Using conformation-specific antibodies against Mtnd4l to detect disease-associated structural changes

    • Development of assays to measure Mtnd4l modifications (oxidation, nitrosylation) as indicators of mitochondrial stress

    • Correlating Mtnd4l alterations with disease progression in animal models

  • Therapeutic Target Validation:

    • Using recombinant Mtnd4l as a screening platform for compounds that can bind and stabilize the protein

    • Testing peptide-based approaches to complement dysfunctional Mtnd4l regions

    • Evaluating gene therapy approaches using in vitro complex assembly systems

  • Structural Biology Applications:

    • High-resolution structural studies of wild-type versus mutant Mtnd4l

    • Analysis of conformational changes during electron transport

    • Structure-guided drug design targeting specific Mtnd4l regions

The association between MT-ND4L variants and Alzheimer's disease identified through whole exome sequencing provides a strong rationale for these investigations, potentially revealing new mitochondrial-targeted therapeutic strategies.

What role does Mtnd4l play in species-specific differences in mitochondrial function and disease susceptibility?

The investigation of species-specific differences in Mtnd4l contributes to our understanding of evolutionary aspects of mitochondrial function and differential disease susceptibility:

  • Evolutionary Conservation Analysis:

    • Comparative genomics of Mtnd4l across species reveals conserved functional domains

    • Identification of regions under positive or negative selection pressure

    • Correlation of sequence variations with species-specific metabolic requirements

  • Functional Divergence Studies:

    • Heterologous expression of rat versus human ND4L in cellular models

    • Measurement of Complex I activity, ROS production, and ATP synthesis efficiency

    • Analysis of compensatory mechanisms in different species

  • Disease Model Relevance:

    • Assessment of whether rat models accurately represent human MT-ND4L-related diseases

    • Identification of species-specific protective mechanisms against mitochondrial dysfunction

    • Translation of findings from rat studies to human therapeutic approaches

  • Metabolic Adaptation Analysis:

    • Correlation of Mtnd4l variations with species-specific metabolic rates

    • Investigation of tissue-specific expression patterns across species

    • Relationship between Mtnd4l variants and environmental adaptation

  • Interactome Divergence:

    • Characterization of differences in protein-protein interaction networks between species

    • Identification of species-specific regulatory mechanisms for Complex I assembly

    • Evaluation of nuclear-mitochondrial genomic compatibility between species

Rat models have proven valuable for cardiac and nerve physiology studies compared to mice , suggesting that differences in mitochondrial proteins like Mtnd4l may contribute to these species-specific characteristics and their suitability for modeling human diseases.

What approaches can overcome the challenges of expressing and purifying recombinant Mtnd4l for structural studies?

The expression and purification of recombinant Mtnd4l for structural studies present significant technical challenges that can be addressed through these specialized approaches:

  • Cell-Free Protein Synthesis:

    • Avoids cellular toxicity issues associated with membrane protein overexpression

    • Allows direct incorporation into nanodiscs or liposomes during synthesis

    • Permits the use of unnatural amino acids for biophysical studies

    • Enables isotopic labeling for NMR studies

  • Split-Intein Mediated Approaches:

    • Expression of Mtnd4l in segments that are later joined through protein trans-splicing

    • Reduces toxicity while achieving full-length protein production

    • Allows differential labeling of protein segments

  • Specialized Membrane Mimetics:

    • SMALPs (Styrene Maleic Acid Lipid Particles) to extract membrane proteins with their native lipid environment

    • Peptidisc scaffold systems for stabilization without detergents

    • Amphipol-based stabilization for cryo-EM studies

  • Fusion Partner Strategies:

    • Maltose-binding protein (MBP) or other solubility-enhancing tags

    • Fluorescent protein fusions for tracking during purification

    • Self-cleaving tags for native protein recovery

  • Chromatography Optimization:

    • Specialized detergent mixtures for extraction and purification

    • Lipid-detergent mixed micelles to maintain native-like environment

    • Multiple orthogonal purification steps at reduced temperatures

  • Stabilization Approaches:

    • Complex I assembly factor co-expression

    • Nanobody or antibody fragment co-purification

    • Engineering disulfide bonds for conformational stabilization

These methods can be combined as appropriate based on the specific downstream structural biology technique to be employed (X-ray crystallography, cryo-EM, NMR, etc.) and the quantity and purity of protein required.

How can one design experiments to investigate the specific contribution of Mtnd4l to Complex I function?

Designing experiments to isolate the specific contribution of Mtnd4l to Complex I function requires sophisticated approaches that can distinguish its role from other subunits:

  • Site-Directed Mutagenesis Studies:

    • Systematic mutation of conserved residues in recombinant Mtnd4l

    • Incorporation into Complex I assembly systems

    • Measurement of electron transfer kinetics for each variant

    • Correlation of structure-function relationships

  • Complementation Assays:

    • Development of cellular systems with endogenous Mtnd4l dysfunction

    • Rescue experiments with wild-type or mutant recombinant Mtnd4l

    • Quantitative assessment of restored Complex I function

  • Domain Swapping Experiments:

    • Creation of chimeric proteins with domains from other species or homologous proteins

    • Functional assessment of hybrid complexes

    • Identification of critical regions for specific functions

  • Inducible Expression Systems:

    • Since complete knockout is not feasible due to lack of swappable codons

    • Titratable expression systems to modulate Mtnd4l levels

    • Correlation of expression levels with Complex I assembly and function

  • High-Resolution Respirometry:

    • Substrate-specific oxygen consumption measurements

    • Inhibitor titration experiments targeting different Complex I domains

    • Comparison between systems with wild-type and modified Mtnd4l

  • Real-Time Monitoring Approaches:

    • Development of fluorescent or bioluminescent reporters of Complex I activity

    • Direct visualization of electron transfer in reconstituted systems

    • Correlation of activity with structural changes using FRET-based approaches

These experimental designs must account for the technical limitation that ND4L cannot be depleted using conditional knockout approaches that work for other mitochondrial proteins, necessitating these alternative strategies .

How does the function of Mtnd4l compare across different species, and what does this reveal about evolutionary conservation?

Comparative analysis of Mtnd4l across species provides valuable insights into the evolutionary constraints on this essential mitochondrial protein:

SpeciesSequence Similarity to HumanKey Functional DifferencesEvolutionary Implications
RatHigh (~85-90%)Similar core function, subtle differences in regulatory interactionsRecent divergence, conserved function
MouseHigh (~85-90%)Similar to rat, minor variations in transmembrane domainsConserved functional constraints
PrimatesVery high (>95%)Highly conserved structure and functionEssential role with little tolerance for variation
BirdsModerate (~70-80%)Adaptations for higher metabolic rateSelection pressure for enhanced energy production
FishModerate (~60-70%)Adaptations for varying oxygen environmentsEnvironmental adaptation influences
InsectsLower (~40-50%)Significant structural variations while maintaining core functionDistant divergence with functional conservation

The high degree of conservation of Mtnd4l across vertebrates despite millions of years of evolution underscores its critical role in cellular energy production. Regions with higher conservation likely represent functional domains essential for electron transport, ubiquinone binding, or interactions with other Complex I subunits. Conversely, variable regions may reflect species-specific adaptations to different metabolic demands or environmental conditions.

The study of these evolutionary patterns provides context for understanding how mutations in human MT-ND4L can lead to pathological conditions like Leber hereditary optic neuropathy and potential associations with Alzheimer's disease .

What insights can be gained from studying the interaction between nuclear and mitochondrial genomes in the context of Mtnd4l function?

The interaction between nuclear and mitochondrial genomes in the context of Mtnd4l function represents a fascinating area of research with implications for understanding mitochondrial diseases:

  • Mitonuclear Compatibility:

    • Complex I contains both mitochondrially-encoded (including Mtnd4l) and nuclear-encoded subunits

    • Proper assembly and function require precise coordination between these components

    • Evolutionary co-adaptation ensures compatibility between mitochondrial and nuclear variants

    • Disruption of this compatibility can lead to energetic deficits and disease

  • Compensatory Mechanisms:

    • Nuclear genome can adapt to compensate for mitochondrial mutations

    • Nuclear-encoded proteins may have evolved to enhance or rescue impaired Mtnd4l function

    • Studies of nuclear gene expression in response to Mtnd4l variants can reveal these adaptations

  • Hybrid Incompatibility:

    • Crossing different strains or species can reveal incompatibility between nuclear and mitochondrial genomes

    • Dysfunction may emerge when Mtnd4l from one genetic background interacts with nuclear-encoded Complex I components from another

    • These studies provide natural experiments in mitonuclear interactions

  • Retrograde Signaling:

    • Mitochondrial dysfunction, including from Mtnd4l variants, triggers nuclear responses

    • Altered Mtnd4l function can initiate specific nuclear gene expression patterns

    • This retrograde signaling represents a critical adaptation mechanism

  • Therapeutic Targeting:

    • Understanding mitonuclear interactions offers potential therapeutic approaches

    • Nuclear-encoded compensatory proteins could be upregulated to address Mtnd4l dysfunction

    • TAMM41, a mitochondria-related nuclear gene, has been identified alongside MT-ND4L in Alzheimer's disease association studies , highlighting the importance of these interactions

The finding that TAMM41 expression was lower in Alzheimer's disease cases than controls provides concrete evidence of the clinical relevance of these mitonuclear interactions, suggesting potential therapeutic avenues targeting both mitochondrial and nuclear components of mitochondrial function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.