Recombinant Rat NEDD4 family-interacting protein 1 (Ndfip1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ndfip1; N4wbp5; NEDD4 family-interacting protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ndfip1
Target Protein Sequence
MALALAALAAVEPACGTGYQQLQNEEEPGEREQTAGDAPPPYSSISAESAAYFDYKDESG FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY
Uniprot No.

Target Background

Function

NEDD4 family-interacting protein 1 (NDFIP1) activates HECT domain-containing E3 ubiquitin-protein ligases, such as NEDD4 and ITCH, modulating the stability of their target proteins and consequently influencing numerous cellular processes. Its functions include:

  • Regulation of Immune Response: Prevents chronic T-helper cell-mediated inflammation; restricts proinflammatory cytokine production in Th17 cells; limits effector Th2 T-cell expansion; regulates peripheral T-cell tolerance.
  • Metabolic Regulation: Promotes pancreatic beta-cell death by degrading JUNB and inhibiting the unfolded protein response, reducing insulin secretion.
  • Antiviral Response: Negatively regulates the RLR-mediated antiviral response.
  • Ion Channel Regulation: Negatively regulates KCNH2 potassium channel activity.
  • Neuroprotection: Mediates the ubiquitination of SLC11A2/DMT1 in cortical neurons, protecting against cobalt and iron toxicity; is important for dendrite and dendritic spine development.
  • Regulation of BRAT1 and MAP3K7: Enhances the ubiquitination of BRAT1 and MAP3K7.
  • EGFR Signaling Modulation: Modulates EGFR signaling, potentially controlling the AKT1-to-MAPK8 signaling ratio and cell growth rate; inhibits cell proliferation.

In summary, NDFIP1 plays a critical role in a wide array of cellular processes through its influence on ubiquitin-mediated protein degradation.

Database Links
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane. Cell junction, synapse, synaptosome. Cell projection, dendrite. Secreted.

Q&A

What is Ndfip1 and what is its primary function in cellular systems?

Ndfip1 (NEDD4 family-interacting protein 1) is an adaptor protein that serves as a crucial regulator for the Nedd4 family of E3 ubiquitin ligases. Its primary function is to identify target proteins for ubiquitination by facilitating the interaction between E3 ubiquitin ligases and their substrate proteins . Specifically, Ndfip1 contains PY motifs that interact with the WW domains of HECT E3 ligases, enhancing their catalytic activity by inducing conformational changes .

In neuronal systems, Ndfip1 has multiple functions beyond protein degradation regulation, including:

  • Regulating divalent metal transporter 1 (DMT1) and iron homeostasis

  • Preventing metal toxicity in the central nervous system

  • Supporting the development of neuronal dendrites and spines

  • Contributing to neuronal survival mechanisms

  • Playing a significant role in spatial learning and memory formation

How does Ndfip1 expression vary during spatial learning tasks?

Research reveals a significant correlation between Ndfip1 expression and learning capability. Fast learners in water maze learning tasks demonstrate decreased Ndfip1 mRNA and protein expression levels compared to slow learners . Additionally, spatial training has been shown to decrease Ndfip1 mRNA and protein expression levels in the hippocampus, suggesting that lower Ndfip1 expression correlates with enhanced spatial memory performance .

What key proteins interact with Ndfip1 in neuronal tissue?

In neuronal tissue, particularly in the hippocampus, Ndfip1 primarily interacts with:

Interacting ProteinTypeInteraction EffectFunctional Significance
Nedd4 (Nedd4-1)E3 ubiquitin ligasePromotes ubiquitination of target proteinsDecreases during spatial training
Beclin 1PI3K-III complex componentBecomes ubiquitination targetImportant for spatial memory formation
PTENTumor suppressorBecomes ubiquitination targetCrucial for spatial learning and memory
Robo1Axon guidance receptorSurface expression regulationControls commissural axon crossing

How does Ndfip1 regulate protein ubiquitination and degradation?

Ndfip1 serves as a critical adaptor in the protein degradation pathway through the following mechanisms:

  • Recruitment of E3 ligases: Ndfip1 contains PY motifs that interact with the WW domains of HECT E3 ligases, particularly those of the Nedd4 family .

  • Enhanced catalytic activity: Interaction with Ndfip1 induces conformational changes in HECT E3 ligases, promoting their ubiquitin transfer activity .

  • Target protein interaction: Ndfip1 facilitates the recognition of substrate proteins, bringing them into proximity with E3 ligases for ubiquitination .

  • Protein sorting: Similar to Drosophila Comm, Ndfip1 can regulate the subcellular localization of target proteins (such as Robo1), preventing their surface expression by recruiting them to late endosomes .

  • Degradation pathway selection: Depending on the target protein, Ndfip1-mediated ubiquitination can lead to either proteasomal or lysosomal degradation, as demonstrated by experiments using both MG132 (proteasomal inhibitor) and chloroquine (lysosomal inhibitor) .

The functional importance of the PY motifs has been demonstrated through mutational studies, where PY-mutated Ndfip1 completely fails to reduce surface Robo1 levels, indicating the essential role of E3 ligase recruitment in Ndfip1's regulatory function .

What is the significance of Ndfip1 in axon guidance and neuronal development?

Ndfip1, along with Ndfip2, plays a crucial role in axon guidance through several mechanisms:

  • Regulation of Robo1 receptors: Ndfip proteins prevent the surface expression of mammalian Robo1 receptors by recruiting them to late endosomes, similar to the function of Drosophila Comm .

  • Receptor specificity: Importantly, this regulation shows specificity toward Robo1 and does not affect closely related receptors like Robo2 or other transmembrane proteins such as integrin beta-1 .

  • Commissural axon guidance: In the developing spinal cord, Ndfip1 and Ndfip2 are detected in commissural axons. Their expression prevents premature response to repulsive Slit signals by downregulating Robo1 surface expression .

  • Midline crossing: In Ndfip1 and Ndfip2 single- and double-knockout mice, there is increased Robo1 expression in pre-crossing commissural axons and a significant reduction in midline crossing, highlighting the critical role of these proteins in proper neural development .

This mechanism provides a crucial control point during neural development, allowing commissural axons to cross the midline before becoming responsive to repulsive guidance cues.

What genetic models are available for studying Ndfip1 function?

Several genetic models have been developed to study Ndfip1 function:

  • Ndfip1 knockout-first embryonic stem (ES) cells: Available from the European Mouse Mutant Cell Repository (EuMMCR, clone number: HEPD0764_3_A03) .

  • Conditional knockout mice: The recombinant allele contains a FRT-hBactP-Neo-FRT-loxP cassette with loxP sites flanking Exon 3 of Ndfip1 .

  • Genotyping protocols: Specific primers for genotyping PCR:

PrimerSequence (5'-3')
Ndfip1-Forward-1CTTACTTGCTGCACCATCTGGCCAG
Ndfip1-Forward-2GTCGAGATATCTAGACCCAGCTTTC
Neo-ForwardAGCGAGCACGTACTCGGATG
Ndfip1-ReverseCAAGCTCTAGTCCAGCTTAGGCAAC
  • Ndfip1 conditional heterozygous (cHet) mice: These mice show enhanced spatial memory performance compared to control mice and have higher expression levels of Beclin 1 and PTEN .

  • Ndfip1 siRNA techniques: siRNA transfection can be performed using agents like polyethyleneimine (PEI) for region-specific knockdown studies .

What biochemical techniques are most effective for analyzing Ndfip1-mediated protein regulation?

Several key biochemical techniques have proven effective for studying Ndfip1:

  • Co-immunoprecipitation (co-IP): Essential for detecting protein-protein interactions between Ndfip1, E3 ligases (e.g., Nedd4-1), and their substrate proteins .

  • Ubiquitylation assays: Co-expressing a protein of interest with Ndfip proteins and FLAG-tagged ubiquitin, followed by immunoprecipitation and western blot analysis with anti-FLAG antibodies to assess ubiquitination status .

  • Surface biotinylation assays: To quantify cell surface protein levels through chemical coupling with biotin, isolation of surface fractions, and detection of biotinylated target proteins .

  • Pharmacological inhibition studies: Using inhibitors like:

    • MG132 (proteasomal inhibitor)

    • Chloroquine (lysosomal inhibitor)

    • Heclin (HECT E3 ligase inhibitor)

  • PY motif mutation analysis: Creating mutations in the PY motifs of Ndfip1 to assess their importance in recruiting HECT E3 ligases .

How can researchers express and purify recombinant Ndfip1 for in vitro studies?

For expressing recombinant Ndfip1, researchers can follow these methodological approaches:

  • Plasmid construction: Full-length Ndfip1 can be cloned into mammalian expression vectors like pcDNA3.1 with appropriate tags (e.g., Flag-tag) .

  • Primer design for amplification: Carefully designed primers should include appropriate restriction sites for subcloning:

PurposeConsideration
Forward primersShould include a restriction site (e.g., EcoRI) and start codon
Reverse primersShould include a restriction site (e.g., HindIII) and stop codon
  • Transfection protocols: For mammalian expression, Lipofectamine 2000 has been successfully used for Ndfip1 plasmid transfection, with optimal protein expression observed 48 hours post-transfection .

  • Expression systems: COS-7 and HeLa cells have been successfully used for overexpression studies of Ndfip1 .

  • Functional validation: Confirming activity through ubiquitination assays and protein interaction studies is essential after purification .

How does Ndfip1 contribute to spatial memory formation at the molecular level?

Ndfip1 influences spatial memory formation through a complex molecular pathway:

  • Inverse correlation with learning: Fast learners exhibit decreased Ndfip1 expression compared to slow learners, and spatial training decreases Ndfip1 expression levels .

  • Regulation of Nedd4-1 interactions: Spatial training decreases the association between Ndfip1 and the E3 ubiquitin ligase Nedd4-1 in the hippocampus .

  • Control of key memory proteins: Beclin 1 and PTEN are endogenous ubiquitination targets of Nedd4 in the hippocampus .

  • Protein stabilization mechanism: Spatial training decreases endogenous Beclin 1 and PTEN ubiquitination and increases their expression levels in the hippocampus .

  • Functional significance: Becn1 conditional knockout mice and Pten conditional knockout mice both show impaired spatial learning and memory performance, confirming the importance of these proteins in memory formation .

  • Enhanced memory in Ndfip1 reduction: Ndfip1 conditional heterozygous mice show enhanced spatial memory performance, likely due to increased expression of Beclin 1 and PTEN resulting from decreased ubiquitination and degradation .

What is the specificity of Ndfip1 toward different target proteins?

Ndfip1 demonstrates notable specificity in its regulation of target proteins:

  • Robo receptor specificity: Overexpression of Ndfip proteins reduces Robo1 levels but has no effect on closely related Robo2 receptors .

  • Transmembrane protein selectivity: Ndfip proteins specifically regulate Robo1 but have no effect on other transmembrane proteins like integrin beta-1 receptor .

  • E3 ligase interactions: The PY motifs in Ndfip1 specifically interact with the WW domains of HECT E3 ligases, particularly those of the Nedd4 family .

  • Substrate selection: In the hippocampus, Ndfip1 specifically regulates the ubiquitination of Beclin 1 and PTEN through its interaction with Nedd4-1 .

This specificity suggests that Ndfip1 doesn't indiscriminately enhance ubiquitination but rather plays a targeted role in regulating specific proteins in different cellular contexts.

How do signaling pathways modulate Ndfip1 function during neuronal development?

Although the search results don't provide comprehensive information on all signaling pathways that modulate Ndfip1, they indicate:

  • Activity-dependent regulation: Spatial training decreases Ndfip1 expression levels, suggesting activity-dependent regulation during learning .

  • PI3K-III complex interaction: Beclin 1, a core component of the PI3K-III complex, is regulated by Ndfip1 through Nedd4-mediated ubiquitination .

  • PTEN/PI3K pathway influence: By regulating PTEN ubiquitination and degradation, Ndfip1 potentially influences PI3K pathway activity, which is critical for neuronal development and function .

  • Axon guidance signaling: In the developing spinal cord, Ndfip proteins regulate Robo1 levels and localization, preventing premature response to the repulsive guidance cue Slit .

What factors can affect the efficiency of Ndfip1-mediated protein degradation in experimental systems?

Several factors can influence Ndfip1-mediated protein degradation:

  • PY motif integrity: Mutations in the PY motifs of Ndfip1 disrupt its ability to recruit HECT E3 ligases, preventing target protein degradation .

  • E3 ligase activity: Inhibition of HECT E3 ligase activity with inhibitors like Heclin significantly attenuates Ndfip1-mediated protein ubiquitination .

  • Degradation pathway balance: Both proteasomal and lysosomal pathways can be involved in the clearance of Ndfip1-ubiquitinated proteins, so both pathways should be considered when studying specific targets .

  • Target protein specificity: Not all proteins are equally regulated by Ndfip1; researchers should consider the specificity of Ndfip1 for their protein of interest .

  • Expression levels: The relative expression levels of Ndfip1, E3 ligases, and target proteins can affect the efficiency of the degradation process .

How can researchers distinguish between the roles of Ndfip1 and Ndfip2 in experimental settings?

To distinguish between Ndfip1 and Ndfip2 functions:

  • Single knockout models: Compare phenotypes of Ndfip1 and Ndfip2 single-knockout mice to identify protein-specific functions .

  • Double knockout analysis: Examine whether effects are additive or synergistic in double-knockout models .

  • PY motif mutations: Compare the effects of PY motif mutations in Ndfip1 versus Ndfip2; the search results indicate that PY-mutated Ndfip1 completely restores surface Robo1, while PY-mutated Ndfip2 only partially restores it .

  • Target specificity assessment: Systematically test whether specific target proteins are preferentially regulated by either Ndfip1 or Ndfip2 .

  • Tissue-specific expression analysis: Examine whether Ndfip1 and Ndfip2 show different expression patterns in various tissues or developmental stages .

What are the potential therapeutic implications of targeting Ndfip1 for cognitive enhancement?

The findings on Ndfip1's role in spatial memory suggest several therapeutic possibilities:

  • Cognitive enhancement strategy: Since Ndfip1 conditional heterozygous mice show enhanced spatial memory performance, partial inhibition of Ndfip1 might represent a strategy for cognitive enhancement .

  • Target protein stabilization: Targeting Ndfip1 could potentially increase the expression of memory-promoting proteins like Beclin 1 and PTEN by decreasing their ubiquitination and degradation .

  • Balancing approach needed: Complete inhibition might be detrimental since Ndfip1 has multiple functions in the nervous system, including regulating iron homeostasis and neuronal development .

  • Pathway-specific modulation: Developing compounds that specifically disrupt the interaction between Ndfip1 and Nedd4 without affecting other Ndfip1 functions could provide more targeted cognitive enhancement .

What are the unexplored aspects of Ndfip1 function in neuronal systems?

Several aspects of Ndfip1 function remain to be fully explored:

  • Developmental regulation: The temporal regulation of Ndfip1 expression during brain development and its impact on neuronal connectivity .

  • Synaptic plasticity mechanisms: While Ndfip1 is implicated in spatial memory, the specific synaptic mechanisms through which it influences memory formation require further investigation .

  • Additional targets: Beyond Beclin 1, PTEN, and Robo1, other neuronal proteins that might be regulated by Ndfip1 remain to be identified .

  • Cell-type specificity: The potential differences in Ndfip1 function across different neuronal and glial cell types .

  • Interaction with other signaling pathways: How Ndfip1 function integrates with other major neuronal signaling cascades beyond those identified in the current research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.