Recombinant Rat Neuromedin-B receptor (Nmbr)

Shipped with Ice Packs
In Stock

Description

Neuronal and Pain Modulation

  • T-Type Calcium Channel Regulation: Activation of recombinant Nmbr in rat trigeminal ganglion neurons enhances Cav3.2 T-type Ca²⁺ currents via a Gβγ-dependent AMPK/PKA pathway, increasing neuronal excitability and pain hypersensitivity .

  • Behavioral Effects: Intrathecal Nmb administration in rats induces nociceptive reflexes, which are blocked by Nmbr antagonists like BIM23042 .

Immune Response

  • Antiviral Activity: Nmbr expression is upregulated during H1N1 influenza infection in murine models. Recombinant Nmbr activation boosts IFN-α production and reduces viral replication, suggesting a role in innate immunity .

Reproductive Regulation

  • Testosterone Secretion: In primary porcine Leydig cells (a model for rat studies), Nmbr activation increases testosterone synthesis by upregulating steroidogenic enzymes (STAR, CYP11A1) .

  • Cell Proliferation: Nmbr signaling promotes Leydig cell proliferation via Cyclin B1 and PCNA upregulation while suppressing apoptosis .

Pain and Neuropathy Studies

  • Key Finding: Nmbr antagonists reduce mechanical hypersensitivity in murine inflammatory pain models, with Cav3.2 channel inhibition attenuating hyperexcitability .

Table 2: In Vivo Effects of Nmbr Modulation

ModelInterventionOutcomeReference
Mouse TG neuronsNmbR siRNAReduced Cav3.2 current and pain response
PR8-infected miceNmb treatmentIncreased survival, decreased viral load

Cancer and Cell Growth

  • Tumorigenesis: Nmbr is implicated in lung and gastrointestinal tumor growth, with antagonists showing potential therapeutic utility .

Technical Considerations

  • Assay Systems: Recombinant Nmbr is frequently used in GTPγS binding assays to study Gq protein coupling .

  • Antibodies and Tools: Commercial products include ChemiScreen™ membranes expressing recombinant human/rat chimeric Nmbr for high-throughput screening .

Challenges and Future Directions

  • Species-Specific Differences: While rat Nmbr shares functional conservation with human and porcine variants, ligand affinity variations necessitate caution in translational research .

  • Therapeutic Potential: Targeting Nmbr pathways could yield novel analgesics or antiviral agents, though off-target effects on endocrine functions require evaluation .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Nmbr; Neuromedin-B receptor; NMB-R; Neuromedin-B-preferring bombesin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MPPRSLPNLSLPTEASESELEPEVWENDFLPDSDGTTAELVIRCVIPSLYLIIISVGLLG NIMLVKIFLTNSTMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIP AIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGVVLWTSLKAVGIWVVSVLLAVPEAV FSEVARIGSSDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLI RSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFVFCWFPNHILYLYRSFNYKEIDPSL GHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGQKSYPERSTSYLLSSSAV RMTSLKSNAKNVVTNSVLLNGHSTKQEIAL
Uniprot No.

Target Background

Function
Receptor for neuromedin-B.
Gene References Into Functions
  1. Peptidergic pathways form a core sigh control circuit, integrating physiological and potentially emotional inputs to modulate breathing patterns from normal breaths to sighs. PMID: 26855425
Database Links

KEGG: rno:25264

UniGene: Rn.89709

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain (olfactory bulb and central thalamic regions), and esophagus.

Q&A

What is the Neuromedin-B receptor (Nmbr) and what are its structural features?

Neuromedin-B receptor (Nmbr) is a G protein-coupled receptor belonging to the bombesin receptor family that specifically binds the peptide neuromedin B (NMB). In rats, Nmbr contains 390 amino acids with seven transmembrane domains characteristic of GPCRs . The rat Nmbr gene is located on chromosome 1p13 . The protein structure of rat Nmbr shows high conservation with human (NMBR), mouse (Nmbr), and other mammalian homologs, particularly in the transmembrane domains that form the ligand-binding pocket . When investigating rat Nmbr, researchers should note that it shares structural features with other bombesin receptors but has distinct pharmacological profiles and tissue distribution patterns.

How does the binding affinity of NMB to rat Nmbr compare with other bombesin-like peptides?

Binding studies using rat tissue and cell lines expressing Nmbr demonstrate a clear preference for NMB over other bombesin-like peptides. In competitive binding assays, the relative potencies for rat Nmbr are: NMB (1.7 nM) ≈ litorin (3 nM) > ranatensin (8 nM) > bombesin (19 nM) > neuromedin C (210 nM) > gastrin-releasing peptide (GRP) (500 nM) . This pharmacological profile distinctly differentiates Nmbr from the GRP-preferring receptor, where the affinity ranking is different: bombesin ≈ litorin (4 nM) > ranatensin, neuromedin C, GRP (15-20 nM) > NMB (351 nM) . When designing ligand-binding experiments, researchers should consider these differential binding affinities to ensure specificity when targeting rat Nmbr.

What is the tissue distribution pattern of Nmbr in rats?

Unlike NMB, which is primarily expressed in the central nervous system (CNS), Nmbr shows a broader distribution pattern with high expression in peripheral tissues . Immunohistochemical and RT-PCR analyses reveal Nmbr expression in:

  • Central nervous system (particularly in areas involved in thermoregulation and respiratory control)

  • Gastrointestinal tissues (smooth muscle)

  • Reproductive organs

  • Skeletal muscle

  • Sensory neurons, including trigeminal ganglion

  • Respiratory-related centers in the pons and medulla

  • Retrotrapezoid nucleus (RTN) neurons

When studying Nmbr expression, a combination of techniques including qRT-PCR, immunohistochemistry, and in situ hybridization is recommended for comprehensive tissue mapping.

How can recombinant rat Nmbr be effectively expressed and purified for research purposes?

For expressing functional rat Nmbr protein:

  • Expression System Selection: E. coli systems are suitable for producing the receptor's extracellular domains, while mammalian expression systems (HEK293 or CHO cells) are preferred for full-length functional receptors .

  • Vector Design: Use mammalian expression vectors containing strong promoters (CMV) and appropriate selection markers. Include epitope tags (His, FLAG) for purification and detection.

  • Transfection Methods: For stable cell lines, use lipofection or electroporation followed by antibiotic selection . Verify expression using:

    • RT-PCR for mRNA expression

    • Western blotting for protein detection

    • Radioligand binding assays using 125I-labeled ligands (e.g., 125I-[D-Tyr0]NMB)

  • Functional Verification: Confirm receptor activity through:

    • Calcium mobilization assays

    • Inositol phosphate accumulation measurements

    • cAMP assays

    • GTPγS binding studies

What are the most reliable methods for characterizing Nmbr binding kinetics?

For precise characterization of rat Nmbr binding kinetics:

  • Radioligand Binding Assays: Use 125I-[D-Tyr0]NMB for:

    • Saturation binding to determine Bmax and Kd values

    • Competition binding with unlabeled ligands to determine Ki values

    • Association and dissociation kinetics to determine kon and koff rates

  • Protocol Considerations:

    • Use cell membranes expressing recombinant rat Nmbr

    • Perform binding at different temperatures (4°C, 25°C, 37°C) to assess temperature dependence

    • Include appropriate positive controls (rat esophageal tissue) and negative controls

    • Use specific buffers (typically containing protease inhibitors) to maintain receptor integrity

  • Analysis Methods:

    • Apply nonlinear regression analyses for saturation and competition curves

    • Use Scatchard plot analysis for receptor density determination

    • Calculate binding constants using appropriate software (GraphPad Prism)

How can Nmbr knockdown or knockout be achieved for functional studies?

Several effective approaches exist for modulating rat Nmbr expression:

  • siRNA/shRNA Approach:

    • Design target-specific sequences against rat Nmbr mRNA

    • Deliver using viral vectors (adenovirus, lentivirus) for higher efficiency

    • Validate knockdown efficiency using qRT-PCR and western blot

    • Optimal knockdown typically achieved 48-72 hours post-transfection

  • CRISPR/Cas9 Gene Editing:

    • Design guide RNAs targeting early exons of the rat Nmbr gene

    • Use cell lines like C-6 glioblastoma cells that express endogenous Nmbr

    • Validate editing via sequencing and functional assays

  • Transgenic Knockout Models:

    • Cre-loxP system allows for conditional, tissue-specific knockout

    • Global Nmbr-KO mice show altered phenotypes in:

      • Energy metabolism (resistance to diet-induced obesity)

      • Mitochondrial function in skeletal muscle

      • Adipogenesis

      • Thermoregulation

  • Pharmacological Inhibition:

    • Use selective antagonists like BIM-23127 (D-Nal-cyclo-[Cys-Tyr-D-Trp-Orn-Val-Cys]-2-Nal-NH2)

    • PD168368 is effective for acute inhibition studies

What are the primary signaling pathways activated by rat Nmbr stimulation?

Rat Nmbr primarily couples to the following signaling pathways:

  • Gq/11 Protein Pathway:

    • Activates phospholipase C (PLC)

    • Generates inositol trisphosphate (IP3) and diacylglycerol (DAG)

    • Increases intracellular calcium mobilization

    • Activates protein kinase C (PKC)

  • Gβγ-Dependent Pathways:

    • AMPK/PKA signaling pathway

    • Important for effects on Cav3.2 T-type calcium channels in sensory neurons

  • Downstream Effectors:

    • MAPK pathways (ERK1/2)

    • RELA (NF-κB p65)/IL6 pathway in smooth muscle (relevant to labor induction)

To study these pathways, researchers should employ:

  • Calcium imaging with fluorescent indicators (Fura-2)

  • Western blotting for phosphorylated proteins

  • Reporter gene assays for transcription factor activation

  • Pharmacological inhibitors of specific pathway components

  • Patch-clamp recordings for ion channel modulation

How does rat Nmbr function differ from human NMBR in experimental systems?

While rat Nmbr shares structural homology with human NMBR, several functional differences are important when designing translational studies:

  • Pharmacological Profile:

    • Rat Nmbr shows slightly different binding affinities for antagonists compared to human NMBR

    • BIM-23127 exhibits comparable potency at both receptors, but other antagonists show species-selective differences

  • Expression Patterns:

    • Female rats exhibit higher Nmb expression in skeletal muscle compared to males

    • Sex hormone effects on expression may differ between species

  • Physiological Functions:

    • Rat Nmbr's role in thermoregulation is more pronounced than in humans

    • Respiratory control mechanisms through RTN Nmbr-expressing neurons show some species differences

  • Signal Transduction:

    • While both couple primarily to Gq/11, downstream effector coupling efficiency may vary

    • Species differences in βγ subunit interactions have been observed

When performing cross-species comparisons, researchers should use:

  • Direct side-by-side binding studies with human and rat receptors

  • Calcium mobilization assays in cells expressing each receptor

  • Cross-species functional assays (e.g., smooth muscle contraction)

What are the latest findings regarding Nmbr's role in mitochondrial function and energy metabolism?

Recent research has revealed important roles for Nmbr in mitochondrial function and energy metabolism:

  • Skeletal Muscle Metabolism:

    • Female Nmbr-knockout mice show enhanced mitochondrial oxidative phosphorylation capacity in gastrocnemius muscle

    • Nmbr deficiency leads to increased O2 consumption coupled with ATP synthesis (1.67-fold higher than wild-type)

    • Respiratory control ratio (RCR) is elevated (1.29-fold) in Nmbr-knockout mice

  • Molecular Alterations:

    • Higher protein levels of ATP-synthase and Nduf9 mRNA (complex I subunit)

    • Increased expression of Myh7 mRNA, characteristic of type I oxidative muscle fibers

    • Enhanced Z-line thickness and slight increase in mitochondrial number

  • Direct NMB Effects on Muscle Cells:

    • L6 myocytes treated with NMB (5 μg/mL for 16 hours) show lower O2 consumption coupled to ATP synthesis

    • This suggests direct action of NMB-Nmbr signaling on skeletal muscle cells

  • Metabolic Phenotypes:

    • Female Nmbr-knockout mice exhibit resistance to diet-induced obesity without hyperphagia

    • This suggests increased energy expenditure through enhanced oxidative metabolism

Research approaches should include:

  • High-resolution respirometry of permeabilized muscle fibers

  • Transmission electron microscopy for mitochondrial morphology

  • qRT-PCR and Western blotting for metabolic genes/proteins

  • In vivo metabolic phenotyping (CLAMS/metabolic cages)

How can rat Nmbr be utilized as a target for respiratory control research?

Neuromedin B receptor-expressing neurons in the retrotrapezoid nucleus (RTN) play crucial roles in respiratory control, presenting opportunities for advanced respiratory research:

  • Chemoreceptor Function:

    • RTN Nmb-expressing neurons are fundamental for respiratory homeostasis

    • They mediate hypercapnic ventilatory responses (reaction to increased CO2)

    • Selective ablation of these neurons causes:

      • Compensated respiratory acidosis due to alveolar hypoventilation

      • Profound breathing instability

      • Respiratory-related sleep disruption

      • Hypoxemia at rest

      • Severe apneas during hyperoxia

  • Experimental Approaches:

    • Generate Nmb-Cre transgenic mice for cell-specific manipulation

    • Use Cre-dependent cell ablation techniques

    • Apply optogenetic stimulation/inhibition of Nmb-expressing neurons

    • Perform whole-body plethysmography to measure ventilatory parameters

    • Conduct arterial blood gas analysis to assess respiratory efficacy

  • Neuroanatomical Considerations:

    • RTN Nmb-expressing neurons are highly collateralized

    • They innervate respiratory-related centers in the pons and medulla

    • They show strong ipsilateral projection preference

This research area has clinical implications for understanding sleep-disordered breathing disorders and central respiratory control mechanisms.

What is known about the role of rat Nmbr in immune response regulation?

Emerging evidence indicates that rat Nmbr plays significant roles in immune regulation:

  • Antiviral Responses:

    • Nmbr expression increases in response to influenza A virus (IAV) infection

    • In A549 cells, Nmbr expression was significantly increased at 6, 9, and 12 hours post-infection with IAV

    • Disrupting Nmbr function influences the innate immune response to IAV infection

  • Cytokine Modulation:

    • Nmbr influences interferon alpha expression (enhancing effect)

    • It reduces interleukin-6 (IL-6) expression

    • The receptor is involved in NF-κB signaling pathways relevant to inflammation

  • Experimental Approaches:

    • Generate Nmbr-deficient cell lines using shRNA knockdown

    • Assess viral replication through titration of viral particles

    • Measure cytokine expression using qRT-PCR and ELISA

    • Analyze transcription factor activation via luciferase reporter assays

    • Perform time-course studies following pathogen exposure

  • Therapeutic Implications:

    • Nmbr signaling may represent a target for modulating excessive inflammatory responses

    • Selective antagonists might have applications in inflammatory conditions

How does Nmbr function in sensory neuron Ca2+ channel modulation and pain signaling?

Recent research has uncovered a sophisticated mechanism by which rat Nmbr regulates Cav3.2 T-type calcium channels in sensory neurons:

  • Signaling Cascade:

    • Nmbr activation increases T-type calcium channel currents (IT) in small-sized trigeminal ganglion neurons

    • This effect is concentration-dependent and reversible

    • The pathway involves:

      • Gq protein-coupling (but independent of PKC activity)

      • Gβγ-dependent signaling (verified by QEHA peptide application and shRNA knockdown)

      • AMPK/PKA pathway activation

  • Experimental Methods for Investigation:

    • Patch-clamp recording of isolated trigeminal ganglion neurons

    • Western blot analysis for phospho-AMPK measurements

    • Immunofluorescent labeling to identify Nmbr-expressing neurons

    • ELISA for measuring signaling molecules

    • shRNA knockdown for receptor reduction

    • Animal behavior tests for pain sensitivity

  • Neuronal Subtypes:

    • Nmbr is expressed in specific subpopulations of sensory neurons

    • Co-labeling studies with markers like CGRP and NF-200 help identify these populations

    • Functional studies can correlate Nmbr expression with specific sensory modalities

  • Physiological Implications:

    • This pathway represents a potential mechanism for modulating peripheral pain sensitivity

    • Targeting Nmbr might provide novel approaches for pain management

    • Cross-talk with other nociceptive pathways requires further investigation

What are the methodological challenges in studying cross-talk between Nmbr and other bombesin-like peptide receptors?

Investigating receptor cross-talk presents several methodological challenges:

  • Selectivity Issues:

    • BIM-23127, originally thought to be a selective Nmbr antagonist, also binds to urotensin-II receptors with similar affinity

    • Results generated with this compound require careful interpretation

    • Many ligands show activity at multiple bombesin receptor subtypes with varying affinities

  • Experimental Approaches to Address Cross-Talk:

    • Use knockout/knockdown models of individual receptors to isolate specific receptor functions

    • Perform cross-desensitization studies to identify shared signaling components

    • Employ receptor-selective antagonists in combination

    • Use receptor-specific antibodies for immunoprecipitation studies

    • BRET/FRET analysis for potential receptor heterodimer formation

  • Cell Model Selection:

    • C-6 glioblastoma cell line expresses predominantly Nmbr

    • Heterologous expression systems with controlled receptor levels

    • Primary cultures from Nmbr-knockout animals as negative controls

  • Functional Readout Considerations:

    • Different bombesin receptors may couple to overlapping but distinct signaling pathways

    • Multiple downstream readouts should be measured simultaneously

    • Temporal resolution of signaling events can help distinguish primary vs. secondary effects

How can findings from rat Nmbr research be translated to human health applications?

Translating rat Nmbr research findings requires careful consideration of species differences and physiological relevance:

  • Respiratory Disorders:

    • RTN Nmb-expressing neurons are essential for respiratory homeostasis

    • Dysfunction of Nmbr signaling might underlie sleep-disordered breathing

    • Therapeutic targeting could potentially address central sleep apnea

  • Metabolic Disorders:

    • Nmbr's role in adipogenesis and muscle energy metabolism suggests potential for obesity interventions

    • Female Nmbr-knockout mice show resistance to diet-induced obesity

    • Nmbr antagonists might enhance skeletal muscle energy expenditure

  • Pain Management:

    • Nmbr modulates T-type calcium channels in sensory neurons

    • Selective Nmbr antagonists could represent novel analgesics

    • Target validation in human tissues is crucial before clinical development

  • Transitional Strategies:

    • Verify key findings in human cells/tissues

    • Develop humanized mouse models expressing human NMBR

    • Use comparative pharmacology to identify compounds with cross-species activity

    • Consider sex differences observed in animal models

What are the current limitations in Nmbr research and future research priorities?

Several important limitations and future directions deserve attention:

  • Technical Limitations:

    • Lack of highly selective antibodies for rat Nmbr

    • Limited availability of receptor subtype-selective ligands

    • Challenges in membrane protein crystallization for structural studies

  • Knowledge Gaps:

    • Incomplete understanding of Nmbr expression during development

    • Limited data on potential Nmbr splice variants

    • Insufficient characterization of potential receptor heterodimers

    • Incomplete picture of sex-specific differences in Nmbr function

  • Future Research Priorities:

    • Develop more selective agonists/antagonists for rat Nmbr

    • Determine high-resolution structures of Nmbr with bound ligands

    • Characterize Nmbr function in additional physiological systems

    • Investigate potential roles in neurological and psychiatric disorders

    • Explore the therapeutic potential of targeting Nmbr in metabolic diseases

  • Emerging Technologies to Apply:

    • Single-cell RNA sequencing to identify Nmbr-expressing cell populations

    • CRISPR-based gene editing for precise receptor modification

    • Advanced tissue clearing and imaging for 3D visualization of Nmbr expression

    • Chemogenetic approaches for cell-specific receptor activation/inhibition

How should researchers design experiments to investigate sex-specific differences in Nmbr function?

Given the observed sex differences in Nmbr expression and function, well-designed experiments are crucial:

  • Experimental Design Considerations:

    • Include both male and female animals in all studies

    • Account for estrous cycle phases in female animals

    • Consider gonadectomy studies with hormone replacement

    • Use age-matched animals (developmental differences may exist)

    • Perform parallel in vitro studies with cells derived from both sexes

  • Key Parameters to Measure:

    • Receptor expression levels (mRNA and protein) in multiple tissues

    • Ligand binding characteristics and signal transduction efficiency

    • Physiological responses to Nmbr activation/inhibition

    • Hormonal influences on receptor expression and function

  • Observed Sex Differences:

    • Female mice show almost twice the Nmb mRNA levels in skeletal muscle compared to males

    • Female Nmbr-knockout mice exhibit stronger phenotypes in metabolic studies

    • Estrogen may have a stimulatory role on Nmb expression

    • Nmbr's role in reproductive function differs between sexes

  • Statistical Analysis Approaches:

    • Two-way ANOVA to assess sex and treatment interactions

    • Sufficient sample sizes to detect potentially subtle sex differences

    • Separate analysis of data from males and females before combining

    • Consideration of hormonal status as a covariate

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.